DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNA14 and Galphaq

DIOPT Version :9

Sequence 1:NP_004288.1 Gene:GNA14 / 9630 HGNCID:4382 Length:355 Species:Homo sapiens
Sequence 2:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster


Alignment Length:393 Identity:260/393 - (66%)
Similarity:304/393 - (77%) Gaps:43/393 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     5 CCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRK 69
            ||||.|.||.:||:.|||:||||||:|||||||||||||||||||||||||||||||||||||::
  Fly     3 CCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKR 67

Human    70 GFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQD 134
            |:.|||:||||.|||:||:|||.|:|.|...::.|.|.::..::.:.|:......:.|||.||.|
  Fly    68 GYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDD 132

Human   135 PGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLE------ 193
            .||||||||||||||:|||||||.|:||:|.|:::||:||:||||||||||||||||||      
  Fly   133 AGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSY 197

Human   194 -------------------------------------NIIFRMVDVGGQRSERRKWIHCFESVTS 221
                                                 .|:|||||||||||||||||||||:|||
  Fly   198 LSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTS 262

Human   222 IIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLIS 286
            ||||||||||||:|.|.|||||||||||||:||||||||.|||||||||||||||||||||||:.
  Fly   263 IIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVD 327

Human   287 YFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLRE 351
            |||||.||::|...||:|||:::.|.|||.||:|||||||||||:||:.||.||||||:|..|:|
  Fly   328 YFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNALKE 392

Human   352 FNL 354
            |||
  Fly   393 FNL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNA14NP_004288.1 G_alpha 16..353 CDD:214595 250/379 (66%)
G-alpha 36..349 CDD:206639 232/355 (65%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 37..50 12/12 (100%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 174..182 6/7 (86%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 197..206 8/8 (100%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 266..273 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 325..330 4/4 (100%)
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 232/355 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 530 1.000 Domainoid score I283
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 562 1.000 Inparanoid score I1089
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - otm41322
orthoMCL 1 0.900 - - OOG6_104168
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.