DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD53 and Tsp74F

DIOPT Version :9

Sequence 1:NP_000551.1 Gene:CD53 / 963 HGNCID:1686 Length:219 Species:Homo sapiens
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:234 Identity:69/234 - (29%)
Similarity:120/234 - (51%) Gaps:31/234 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGMSSL-----KLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNF--GVLFHNLPSLTLGNVFV- 57
            ||.||.     :.:||.||..|.:.::.|..:....::.|:..:|  .:|..||.|   |.|:| 
  Fly     1 MGFSSRMDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFS---GAVYVL 62

Human    58 -IVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDS 121
             :...||.:|:||||:|:.||.||||:::||::.::.:..:...:|.:|:.:::.:.:.:.:..:
  Fly    63 LVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRST 127

Human   122 IHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTS-GP-PASCPSD-----RK-------VEGCYA 172
            :..|.|......|||..|..|||||::...||.. || |.||..:     ||       :...|.
  Fly   128 MALYGSRREITQAWDLTQERLQCCGVDTWHDWNRYGPVPESCCQELFGGQRKECTIFPTITNLYN 192

Human   173 KARLWFHSNFL-----YIGIITICVCVIEVLGMSFALTL 206
            :..|:..:||:     .||..:|.|.::.:.||.|:..|
  Fly   193 QGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD53NP_000551.1 Tetraspannin 9..206 CDD:366035 64/219 (29%)
CD53_like_LEL 104..186 CDD:239417 25/100 (25%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 64/219 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.