DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD53 and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_000551.1 Gene:CD53 / 963 HGNCID:1686 Length:219 Species:Homo sapiens
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:238 Identity:66/238 - (27%)
Similarity:111/238 - (46%) Gaps:42/238 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     5 SLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVF------VIVGSII 63
            |...:||.||.|||:|.|.|..::..|.      ..|.::........|..|      :::||.|
  Fly     7 SANAVKYTLFGFNLIFLITGIILIAVGA------GVGAVYTGYKLFLAGKFFSIPTFLIVIGSFI 65

Human    64 MVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHS- 127
            ::::|.||.|::|||.||::||.::|.||.:.|:...|..:|.....::.:...||.|::.|:| 
  Fly    66 IIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSI 130

Human   128 -DNSTKAAWDSIQSFLQCCGINGTSDW-TSGP----PASC-------------------PSDRKV 167
             .|:|...||.||...:|||:...:|| |:.|    |.||                   .:||..
  Fly   131 NPNATTKLWDDIQDEFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNAQSSVADRHK 195

Human   168 EGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQI 210
            .||......:..::.:.:|...:.:.:::..|:.||    |.|
  Fly   196 VGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFA----CYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD53NP_000551.1 Tetraspannin 9..206 CDD:366035 63/228 (28%)
CD53_like_LEL 104..186 CDD:239417 26/107 (24%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 65/234 (28%)
tetraspanin_LEL 106..210 CDD:239401 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.