DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTRF1 and mRF1

DIOPT Version :9

Sequence 1:XP_011533617.1 Gene:MTRF1 / 9617 HGNCID:7469 Length:497 Species:Homo sapiens
Sequence 2:NP_609617.1 Gene:mRF1 / 34720 FlyBaseID:FBgn0032486 Length:392 Species:Drosophila melanogaster


Alignment Length:395 Identity:147/395 - (37%)
Similarity:225/395 - (56%) Gaps:25/395 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   101 ILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAEL 165
            :|:|.....:||:...|...:...| ||.|:|:|.:||..:          ..|....::.:|.|
  Fly     6 LLNLRLGYLARRWASTDPLSIQNEK-LQAYLESLRQEYYAV----------RVNAAGNSKSYARL 59

Human   166 APLAAIYQEIQETEQAIEELESMCKSLNKQDEKQLQELALEERQT----IDQKINMLYNELFQSL 226
            |.|..:...: |..:.:|...:..|.:..:.::.::||..||.:.    :.::...|..||. :|
  Fly    60 AQLEGVVSAL-EQRRVLERHITSAKDMEAEKDEDMRELMREENEVYVDLLGKQDQALLQELL-TL 122

Human   227 VPKEKYDKNDVILEVTAGRTTGGDICQQFTREIFDMYQNYSCYKHWQFELLNYTPADYGGLHHAA 291
            ...|:|..  :|..:.||  .||.....|.:|:::||..|..:..|::|.......|.|||.||:
  Fly   123 SDDEEYPA--LIFGLNAG--AGGQEAMLFAQELYEMYTGYFEHMGWEWEEFASEGTDIGGLRHAS 183

Human   292 ARISGDGVYKHLKYEGGIHRVQRIPEVGLSSRMQRIHTGTMSVIVLPQPDEVDVKLDPKDLRIDT 356
            ..:||:..::.|:||.|:|||||:|....|.||   ||.|.|:.|:|:|.::.|.:..|||:|:|
  Fly   184 LMVSGEDAFRWLRYEAGVHRVQRVPATEKSGRM---HTSTASITVIPRPADIQVHIAEKDLKIET 245

Human   357 FRAKGAGGQHVNKTDSAVRLVHIPTGLVVECQQERSQIKNKEIAFRVLRARLYQQIIEKDKRQQQ 421
            .||.||||||||.||||||:||:||||.||.|.||||:||:|:|.:.||:||.||.:|..:..:.
  Fly   246 KRASGAGGQHVNTTDSAVRIVHLPTGLAVEAQSERSQLKNRELAMKRLRSRLVQQQLESVEASKM 310

Human   422 SARKLQVGTRAQSERIRTYNFTQDRVSDHRI-AYEVRDIKEFLCGGKGLDQLIQRLLQSADEEAI 485
            :.:|.|.|:..::|:||||||.|||::|||| ...:.::..||.||..|..||::|......|.:
  Fly   311 ATKKAQQGSLNRNEKIRTYNFVQDRITDHRIQGGTLHNLNGFLKGGDQLSGLIEKLQLEHRRERL 375

Human   486 AELLD 490
            .||||
  Fly   376 KELLD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTRF1XP_011533617.1 prfA 131..488 CDD:234801 134/361 (37%)
PCRF 151..334 CDD:281461 54/186 (29%)
RF-1 344..449 CDD:278876 59/104 (57%)
mRF1NP_609617.1 prfA 35..378 CDD:234801 134/361 (37%)
PCRF 58..222 CDD:281461 52/172 (30%)
RF-1 234..338 CDD:278876 59/103 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4791
eggNOG 1 0.900 - - E1_COG0216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I2972
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62484
OrthoDB 1 1.010 - - D1313171at2759
OrthoFinder 1 1.000 - - FOG0001423
OrthoInspector 1 1.000 - - otm41346
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43804
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X991
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.