DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDIA4 and CaBP1

DIOPT Version :9

Sequence 1:NP_001358173.1 Gene:PDIA4 / 9601 HGNCID:30167 Length:646 Species:Homo sapiens
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:410 Identity:128/410 - (31%)
Similarity:191/410 - (46%) Gaps:76/410 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    62 NGVLVLNDANFDNFVADKDTV-LLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSA 125
            :||:.|..:|||..|...|.: ::||||||||||:...|||:|:|..||.   .:.|..::|.:.
  Fly    25 DGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKG---VVKVGSVNADAD 86

Human   126 SVLASRFDVSGYPTIKIL--KKGQAVDYEGSRTQE--------EIVAKVREV--------SQPDW 172
            |.|:.:|.|.|:|||||.  .|....||.|.||.:        |:..||:.|        |....
  Fly    87 STLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSG 151

Human   173 TPPPEVTLVLTKENFDE-VVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVD 236
            :...:..:.||::|||: |:|..||.||||:||||||||.||||:.||||||..:   :.|..:|
  Fly   152 SSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGK---VKLGALD 213

Human   237 ATAETDLAKRFDVSGYPTLKIF-----RKGRPYDYNGPREKYGIVDYMIEQ--SGPPSKEILTL- 293
            |||....|..::|.||||:|.|     |.....:|:|.|....||.:..::  :..|:.|::.: 
  Fly   214 ATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEII 278

Human   294 -KQVQEFLKDGDDVIIIGVFKGESD---PAYQQYQDAANNLREDYKFHH--------------TF 340
             :...|...:|..:.::.|.....|   ....::.|....|.|.:|...              ..
  Fly   279 NESTFETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEE 343

Human   341 STEIAKFLKVSQGQLVVMQPEKFQSKYEPRSHMMDVQQGSTQDSAIKDFV--LKYALPLVGHRKV 403
            |.|:..|   ....:.|:..:|.:         ..|.:||.....|.:|:  :.|..   ||...
  Fly   344 SLEVGGF---GYPAMAVVNFKKMK---------FSVLKGSFSKDGINEFLRDISYGR---GHTAP 393

Human   404 SNDAKRYTRRPLVVVYYSVD 423
            ...||    :|.:|   |||
  Fly   394 VRGAK----KPAIV---SVD 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDIA4NP_001358173.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..58
pdi_dom 67..168 CDD:273454 45/119 (38%)
CXXC. /evidence=ECO:0000250|UniProtKB:P08003 91..94 2/2 (100%)
ER_PDI_fam 177..641 CDD:273457 80/276 (29%)
CXXC. /evidence=ECO:0000250|UniProtKB:P08003 556..559
Prevents secretion from ER 643..646
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 41/95 (43%)
PDI_a_P5 157..262 CDD:239299 50/107 (47%)
Thioredoxin_6 190..383 CDD:290560 50/207 (24%)
P5_C 271..400 CDD:239281 24/147 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.