DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYTIP and gras-1

DIOPT Version :9

Sequence 1:NP_004279.3 Gene:CYTIP / 9595 HGNCID:9506 Length:359 Species:Homo sapiens
Sequence 2:NP_492164.1 Gene:gras-1 / 172549 WormBaseID:WBGene00009272 Length:245 Species:Caenorhabditis elegans


Alignment Length:223 Identity:58/223 - (26%)
Similarity:95/223 - (42%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    23 AYSSYSTLTGSL---TMDDNRRIQ-MLADTVATLPRGRKQLALTRSSSLSDFSW-------SQRK 76
            |:|:.||.:.|.   |.|||...| :|.|.....|             |:|:.:       :||.
 Worm     6 AHSAVSTSSSSSKYDTPDDNISEQRLLCDAKEEYP-------------LNDYLFDGINQESAQRS 57

Human    77 LVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEG 141
            |:...:....:|||.:|||..:..::.|.|..|.:..:..||||...|:..||::..:|..|...
 Worm    58 LLLCRQTFETSFGFALQSYVFKRTSSNSYERITYVDYVSADSPADRCGITRGDMVIAVNEKSVVT 122

Human   142 FTYKQVVDLIRSSGNLLTIETLNGTMIL------KRTELEAKLQVLKQTLKQKWVEYRSLQLQEH 200
            .::.::|:.|        .:.|..:::|      :..||..:...|:..|..|..|.|.|:..|.
 Worm   123 ASHAEIVESI--------AQCLQVSLVLVFKDVARIVELSMRSIQLRFMLDAKIRELRMLEKTEE 179

Human   201 RLL------HGDAANCPSLEN--MDLDE 220
            .|.      ||:.....|||:  .:|||
 Worm   180 DLQALYDDEHGNEEEDESLESTLYELDE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYTIPNP_004279.3 PDZ_signaling 76..161 CDD:238492 21/84 (25%)
Interaction with CYTH1 166..188 5/27 (19%)
gras-1NP_492164.1 PDZ 67..145 CDD:238080 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161454151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.