DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM39 and SGN1

DIOPT Version :9

Sequence 1:NP_909122.1 Gene:RBM39 / 9584 HGNCID:15923 Length:530 Species:Homo sapiens
Sequence 2:NP_012266.1 Gene:SGN1 / 854817 SGDID:S000001440 Length:250 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:39/113 - (34%)
Similarity:62/113 - (54%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   220 GVPIIVQ-ASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMM 283
            |.|.:.| .|:.||:     |:.|:..|..   ::||::..::|.:.:...|:..|:|:.|.|:.
Yeast    41 GTPQVSQKLSKEEKH-----AHQLEADSRS---IFVGNITPDVTPEQIEDHFKDCGQIKRITLLY 97

Human   284 DSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTD 331
            |..||..||||:|.|......:||| ||||.||.|:.:.|..  :||:
Yeast    98 DRNTGTPKGYGYIEFESPAYREKAL-QLNGGELKGKKIAVSR--KRTN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM39NP_909122.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..146
SF-CC1 46..518 CDD:273721 39/113 (35%)
Interaction with JUN. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..406 19/41 (46%)
Activating domain. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..355 19/41 (46%)
Interaction with ESR1 and ESR2. /evidence=ECO:0000250|UniProtKB:Q8VH51 355..406
Interaction with NCOA6. /evidence=ECO:0000250|UniProtKB:Q8VH51 406..530
SGN1NP_012266.1 RRM <16..248 CDD:223796 39/113 (35%)
RRM_II_PABPs 65..137 CDD:409747 27/75 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.