DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDF3 and scw

DIOPT Version :9

Sequence 1:NP_065685.1 Gene:GDF3 / 9573 HGNCID:4218 Length:364 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:215 Identity:66/215 - (30%)
Similarity:92/215 - (42%) Gaps:37/215 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   176 QGAVHFNLLDVAKDWNDN---PRKNFGLFLEILVKEDRDSGVNFQPEDTCARL------RCSLHA 231
            :|.:.|||.|..:.|..|   .|:|          |.|.|..:.|.....|.|      |.||..
  Fly   195 RGWLEFNLTDTLRYWLHNKGLQRRN----------ELRISIGDSQLSTFAAGLVTPQASRTSLEP 249

Human   232 SLLVVTLNPDQC---------HPSRKRRAA---------IPVPKLSCKNLCHRHQLFINFRDLGW 278
            .::.....|:..         ....||||.         .||........|.|....::|::|..
  Fly   250 FIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHM 314

Human   279 HKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQD 343
            |.|:||||.|.|.:|.|.|.|.|...:|::|:|.:|.|||...|.:|:..|:||.|..|::|...
  Fly   315 HNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLPKPCCVPTVLGAITILRYL 379

Human   344 NNDNVILRHYEDMVVDECGC 363
            |.|.:.|..|:..|..||||
  Fly   380 NEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDF3NP_065685.1 TGFb_propeptide <109..220 CDD:279078 13/46 (28%)
TGFB 264..364 CDD:214556 41/100 (41%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 18/68 (26%)
TGFB 300..400 CDD:214556 41/100 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.