DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APBA3 and X11Lbeta

DIOPT Version :9

Sequence 1:XP_006723013.1 Gene:APBA3 / 9546 HGNCID:580 Length:650 Species:Homo sapiens
Sequence 2:NP_727440.3 Gene:X11Lbeta / 31997 FlyBaseID:FBgn0052677 Length:2139 Species:Drosophila melanogaster


Alignment Length:303 Identity:156/303 - (51%)
Similarity:205/303 - (67%) Gaps:15/303 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   215 LLDGVIFGARYLGSTQLVSERNPPTSTRMAQAREAMDRVK--APDGETQPMTEVDLFVSTKRIKV 277
            |::||:|.|:||||||||.|..|..||||.||.||:.|:|  ||||:.||.||||||:||::|.|
  Fly  1772 LIEGVLFRAKYLGSTQLVCEGQPTKSTRMMQAEEAVSRIKALAPDGDVQPSTEVDLFISTEKIMV 1836

Human   278 LTADSQEAMMDHALHTISYTADIGCVLVLMARRRLARRPAPQD-----HGRRLYKMLCHVFYAED 337
            |..|.:|.||||||.||||.||||.::|||||||.    .|||     ...|..||:||||.:::
  Fly  1837 LNTDLKEIMMDHALRTISYIADIGDLVVLMARRRF----VPQDIDDAPKPNRTPKMICHVFESDE 1897

Human   338 AQLIAQAIGQAFAAAYSQFLRESGIDP----SQVGVHPSPGACHLHNGDLDHFSNSDNCREVHLE 398
            ||.|||:|||||..||.:||:.:||:.    .::.......:..:...:|:.|:..:..:||.:.
  Fly  1898 AQFIAQSIGQAFQVAYMEFLKANGIED
HRFVKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVP 1962

Human   399 KRRGEGLGVALVESGWGSLLPTAVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAA 463
            |.:||.|||.:|||||||:|||.|||||:..|.|.|.|.|:|||:|.||||.|||||||:.||..
  Fly  1963 KAKGEILGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTY 2027

Human   464 VRETKSQTSVTLSIVHCPPVTTAIIHRPHAREQLGFCVEDGIV 506
            ::.||:||.|..::|.|.||....|.||..:.||||.|::|::
  Fly  2028 IKNTKNQTVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGVI 2070

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APBA3XP_006723013.1 PTB_X11 212..364 CDD:269919 91/155 (59%)
PDZ 394..477 CDD:278991 50/82 (61%)
X11LbetaNP_727440.3 PTB_X11 1770..1924 CDD:269919 91/155 (59%)
PDZ_signaling 1957..2042 CDD:238492 50/84 (60%)
PDZ_signaling 2047..2120 CDD:238492 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3605
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002645
OrthoInspector 1 1.000 - - mtm8492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2607
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.