DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NRG2 and vn

DIOPT Version :9

Sequence 1:NP_053585.1 Gene:NRG2 / 9542 HGNCID:7998 Length:858 Species:Homo sapiens
Sequence 2:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster


Alignment Length:589 Identity:136/589 - (23%)
Similarity:186/589 - (31%) Gaps:254/589 - (43%)


- Green bases have known domain annotations that are detailed below.


Human    12 PPLEKGRCSSYSDSSSSSSERSSSSSSSSSESG-SSSRSSSNN--------------SSIS---- 57
            |.|.:|.....|.....||:..|.||.||:||| |||||||||              :|:|    
  Fly    56 PRLWEGSAEESSYYIPLSSDNGSGSSESSAESGSSSSRSSSNNIDNNILSRLLSLNSNSLSSRSN 120

Human    58 ---RP------------------AAPPEPRPQQQPQPRS-------------------------- 75
               :|                  ||.||.:.|||.|.:|                          
  Fly   121 VKLKPATVFDAGSSTPAQQEQHVAAVPEQQQQQQQQQQSMQKVPNTLINSQIYNLLYNGMPSEAA 185

Human    76 ------------------------------PAAR-------------------RAAARSR--AAA 89
                                          ||.|                   ..|||||  .:.
  Fly   186 SSKMRRHIQPSQLPHQPESRAQLPSNYSSRPAVRSYLIESYEMPESMLEDRSPEQAARSRRDGSN 250

Human    90 AGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQ------------------------------- 123
            ..|.|:....|....|    ........:..|||                               
  Fly   251 TNGSRQQQRTGHRQQL----QQDKRDHRRQRQDQQKEQRQQQQQRQHKSGNKHQQQQQQRRKHQR 311

Human   124 -----------------AYKAPVVVEG-----------------KVQ------------GLVPAG 142
                             |:.||.|.:|                 ||:            .||...
  Fly   312 KHQRYNRYCSARDPAQLAFAAPTVFQGVFKSMSADRRVNFSATMKVEKVYKQQHDLQLPTLVRLQ 376

Human   143 GSSSNSTREPPASGRVALVKVLDKWPLRSGG-LQREQVISVGSCVPLERNQRYIFFLEPTE---- 202
            .:.|||:.|..    :...:::.:..||||. ||:...||            |:.|::.|.    
  Fly   377 FALSNSSGECD----IYRERLMPRGMLRSGNDLQQASDIS------------YMMFVQQTNPGNF 425

Human   203 ----QP-----LVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCE 258
                ||     ||.:.....:..| .....||.||.     ::|....:|.     |:|..:.||
  Fly   426 TILGQPMRVTHLVVEAVETAVSEN-YTQNAEVTKIF-----SKPSKAIIKH-----GKKLRIVCE 479

Human   259 AAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRL---QFNKVKVEDAGEYVCEAENILGKD 320
             .:|.|.|...||||.|.:||.|:| .::.:.::.|.|   .||  ...|||.|.|.|:|...|.
  Fly   480 -VSGQPPPKVTWFKDEKSINRKRNI-YQFKHHKRRSELIVRSFN--SSSDAGRYECRAKNKASKA 540

Human   321 TVRGRLYVNSVST---TLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCL 382
            ..:.|:.:.:...   |..|.||  ..||   ..||.:.|.|..|..||::.|:||..:||.||.
  Fly   541 IAKRRIMIKASPVHFPTDRSASG--IPCN---FDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCE 600

Human   383 EKLP 386
            .|.|
  Fly   601 NKWP 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NRG2NP_053585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 45/200 (23%)
I-set 239..328 CDD:254352 30/91 (33%)
Ig_Pro_neuregulin 253..326 CDD:143227 26/75 (35%)
PHA02887 <343..383 CDD:165214 16/39 (41%)
Neuregulin 406..845 CDD:280343
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..543
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..593
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 655..689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..796
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 809..858
vnNP_523942.2 IGc2 471..538 CDD:197706 27/70 (39%)
EGF 566..598 CDD:278437 14/34 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28J9V
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40289
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8848
SonicParanoid 1 1.000 - - X2572
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.