DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NRG2 and igcm-4

DIOPT Version :9

Sequence 1:NP_053585.1 Gene:NRG2 / 9542 HGNCID:7998 Length:858 Species:Homo sapiens
Sequence 2:NP_508377.1 Gene:igcm-4 / 180518 WormBaseID:WBGene00022418 Length:541 Species:Caenorhabditis elegans


Alignment Length:200 Identity:51/200 - (25%)
Similarity:81/200 - (40%) Gaps:47/200 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   237 PKLKKMKSQTG-QVGEKQ-SLKCEAAAGNPQPS-YRWFKDGKELNRSRDIRIKYGNGRKNSRLQF 298
            |:::.::::.. .:|:|| .|.|...|.....: .:|.|:|::|    |...:|...:.:..|:.
 Worm    34 PRMRNVETKFRIPLGQKQFRLVCPIIATEKDSTMIQWSKNGEQL----DWDSQYKLSKDSKELKM 94

Human   299 NKVKVEDAGEYVCEAENILGKDTVRGRLYV-------NSV------STTLSSWSGHARKCNETAK 350
            ..||.||:|.|.|:|.|..|..|:...::|       |||      |.|.:|.|......:|...
 Worm    95 KSVKFEDSGRYQCQATNGFGHKTIEFIVHVHDQHDKENSVKDYLVLSNTTASPSWLIDMNSEWRS 159

Human   351 SYCVNGGVCYYIEGINQLSCKCP-NGFFGQRCLEKLP-LRLYMPDPKQKHLGFELKEAEELYQKR 413
            ...:|.|        .:|..:|| .|       ..|| :|.|..:          .|..|...|.
 Worm   160 PIKINTG--------GKLELRCPAQG-------NPLPEIRWYQNE----------MEISEKTHKH 199

Human   414 VLTIT 418
            |.|||
 Worm   200 VSTIT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NRG2NP_053585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96
I-set 239..328 CDD:254352 24/91 (26%)
Ig_Pro_neuregulin 253..326 CDD:143227 22/74 (30%)
PHA02887 <343..383 CDD:165214 7/40 (18%)
Neuregulin 406..845 CDD:280343 5/12 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..543
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..593
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 655..689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..796
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 809..858
igcm-4NP_508377.1 IGc2 52..114 CDD:197706 19/65 (29%)
I-set 159..235 CDD:254352 16/70 (23%)
IGc2 166..225 CDD:197706 15/63 (24%)
IG_like 261..373 CDD:214653
Ig 269..374 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.