Sequence 1: | NP_053585.1 | Gene: | NRG2 / 9542 | HGNCID: | 7998 | Length: | 858 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508377.1 | Gene: | igcm-4 / 180518 | WormBaseID: | WBGene00022418 | Length: | 541 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 51/200 - (25%) |
---|---|---|---|
Similarity: | 81/200 - (40%) | Gaps: | 47/200 - (23%) |
- Green bases have known domain annotations that are detailed below.
Human 237 PKLKKMKSQTG-QVGEKQ-SLKCEAAAGNPQPS-YRWFKDGKELNRSRDIRIKYGNGRKNSRLQF 298
Human 299 NKVKVEDAGEYVCEAENILGKDTVRGRLYV-------NSV------STTLSSWSGHARKCNETAK 350
Human 351 SYCVNGGVCYYIEGINQLSCKCP-NGFFGQRCLEKLP-LRLYMPDPKQKHLGFELKEAEELYQKR 413
Human 414 VLTIT 418 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NRG2 | NP_053585.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..96 | ||
I-set | 239..328 | CDD:254352 | 24/91 (26%) | ||
Ig_Pro_neuregulin | 253..326 | CDD:143227 | 22/74 (30%) | ||
PHA02887 | <343..383 | CDD:165214 | 7/40 (18%) | ||
Neuregulin | 406..845 | CDD:280343 | 5/12 (42%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 500..543 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 574..593 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 655..689 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 708..796 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 809..858 | ||||
igcm-4 | NP_508377.1 | IGc2 | 52..114 | CDD:197706 | 19/65 (29%) |
I-set | 159..235 | CDD:254352 | 16/70 (23%) | ||
IGc2 | 166..225 | CDD:197706 | 15/63 (24%) | ||
IG_like | 261..373 | CDD:214653 | |||
Ig | 269..374 | CDD:299845 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |