DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF254 and trem

DIOPT Version :9

Sequence 1:NP_975011.3 Gene:ZNF254 / 9534 HGNCID:13047 Length:659 Species:Homo sapiens
Sequence 2:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster


Alignment Length:440 Identity:124/440 - (28%)
Similarity:183/440 - (41%) Gaps:88/440 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   137 EGYNGLNQCFT-TAQSKVFQCDKYLKVFYKF---LNSNRPKIRHTEKKSFKCKK------RVKLF 191
            ||...|:..|: ||.:::   |:.|.:....   |:.|.|     :|...||.:      :.:|.
  Fly    21 EGEELLHDIFSETASTRL---DQMLHICAGIPVSLDDNFP-----DKMCSKCVRCLRLCYKFRLT 77

Human   192 CMLSHKTQH-KSIYHREKSYKCKECG-----------------KTF-NWSSTLTNHRKIYTEEK- 236
            |..||  || ..:..||.| .....|                 |:: :::|.|....|:..||. 
  Fly    78 CQRSH--QHIMDMLDREAS-NANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDGGMKVEGEEDQ 139

Human   237 -----PYKCEEYNKSPKQL-----STLTTHEIIHAGEKLYKCEECGEAFNRSSNLTTHKIIHTG- 290
                 .|..|:.:.....:     .|......|...|...:.||.....|.:|.....:...|| 
  Fly   140 QHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELLTNENSPEIAQEKGSTGT 204

Human   291 ----EKPYKCEECGKAFIWSSTLTEHKKIHTRKKPYKCEECGK---AFIWSSTLTRHKRMHTGEK 348
                |:|.: ||..:..:.|.  .::...|.  ||.||:..|:   |:..:|......:...|.|
  Fly   205 DVATEEPPE-EEIAEDILDSD--EDYDPTHA--KPEKCDRSGRKPVAYHKNSPKVETFKKKVGRK 264

Human   349 PYKCEECGKAFSQSSTLTTHKIIHTGEKRYKCLECGKAFKQLSTLTTHKIIHVGEKLYKCEECGK 413
            |            .:.|:|          |.|..||..:...:.||.|...|.|.|.::||.||:
  Fly   265 P------------RNKLST----------YICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGR 307

Human   414 GFNRSSNLTTHKIIHTGEKPYKCEECGKAFIWSSTLTKHKRIHTREKPYKCEECGKAFIWSSTLT 478
            ||.::..|..|...|||.:||||..|..||...||.|||.||||:|:||.|:.|.:.|.:|..|.
  Fly   308 GFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLK 372

Human   479 RHKRMHTGEKPYKCEECGKSFSQSSTLTTHKIIHTGEKPYK--CEECGKA 526
            .||.:||||||:.|:.|||.|.::..|..|:..|.....::  .||..||
  Fly   373 FHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEESTKA 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF254NP_975011.3 KRAB 13..73 CDD:214630
C2H2 Zn finger 184..204 CDD:275368 7/26 (27%)
C2H2 Zn finger 212..260 CDD:275368 10/76 (13%)
COG5048 264..625 CDD:227381 89/273 (33%)
C2H2 Zn finger 268..288 CDD:275368 4/19 (21%)
C2H2 Zn finger 296..316 CDD:275368 3/19 (16%)
C2H2 Zn finger 324..344 CDD:275368 4/22 (18%)
C2H2 Zn finger 352..372 CDD:275368 2/19 (11%)
C2H2 Zn finger 380..400 CDD:275368 6/19 (32%)
C2H2 Zn finger 408..428 CDD:275368 8/19 (42%)
C2H2 Zn finger 436..456 CDD:275368 10/19 (53%)
C2H2 Zn finger 464..484 CDD:275368 7/19 (37%)
C2H2 Zn finger 492..512 CDD:275368 7/19 (37%)
C2H2 Zn finger 520..540 CDD:275368 4/7 (57%)
C2H2 Zn finger 548..568 CDD:275368
C2H2 Zn finger 576..596 CDD:275368
C2H2 Zn finger 604..624 CDD:275368
C2H2 Zn finger 632..652 CDD:275368
tremNP_650861.1 zf-AD 11..87 CDD:214871 20/75 (27%)
COG5048 <264..411 CDD:227381 65/168 (39%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 12/23 (52%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 10/19 (53%)
zf-H2C2_2 345..367 CDD:290200 12/21 (57%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..394 CDD:290200 13/23 (57%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.