DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BAG3 and Nedd4

DIOPT Version :9

Sequence 1:NP_004272.2 Gene:BAG3 / 9531 HGNCID:939 Length:575 Species:Homo sapiens
Sequence 2:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster


Alignment Length:102 Identity:35/102 - (34%)
Similarity:44/102 - (43%) Gaps:28/102 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     8 PMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPSRE 72
            |.|:..:| |:.:||||.|.:::.| .|..||:||.||.|||.||                  |.
  Fly   518 PPMEQNTG-GEEEPLPPRWSMQVAP-NGRTFFIDHASRRTTWIDP------------------RN 562

Human    73 GSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVH 109
            |...|...:...|...|.|       |.||.|.| ||
  Fly   563 GRASPMPNQTRRVEDDLGP-------LPEGWEER-VH 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BAG3NP_004272.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 27/83 (33%)
WW 21..53 CDD:197736 17/31 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..421
BAG 421..498 CDD:214591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..575
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 15/29 (52%)
WW 581..613 CDD:197736 8/19 (42%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11446
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.