DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1E1 and GstD2

DIOPT Version :9

Sequence 1:NP_004271.1 Gene:EEF1E1 / 9521 HGNCID:3212 Length:174 Species:Homo sapiens
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:190 Identity:49/190 - (25%)
Similarity:89/190 - (46%) Gaps:27/190 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAAAAELSLLEKSLGLSKGNKYSAQ-----GERQIPVLQTNNGPSLTGLTTIAAHLVKQANK-EY 59
            :|.|..|.|.:|.|...:|.:...:     .:..||.| .:||.|:.....||.:||::..| :|
  Fly    18 VAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTL-VDNGFSIWESRAIAVYLVEKYGKDDY 81

Human    60 LLGSTAEEKAIVQQWL--------------EYRVTQVDGHSSKND---IHTLLKDLNSYLEDKVY 107
            ||.:..:::|::.|.|              .|.:.:.....|..|   |.|....|:::||.:.|
  Fly    82 LLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLDTFLEGQEY 146

Human   108 LTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHY-PGIRQHLSSVVFIK 166
            :.|...|:|||.:...:..|  :::..:..||.|||||:.:.:.. ||..::...::.:|
  Fly   147 VAGDQLTVADIAILSTVSTF--EVSEFDFSKYSNVSRWYDNAKKVTPGWDENWEGLMAMK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1E1NP_004271.1 N-terminal 2..56 17/58 (29%)
Linker 57..63 4/6 (67%)
C-terminal 64..152 25/104 (24%)
GST_C_AIMP3 65..165 CDD:198338 27/117 (23%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/56 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.