DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1E1 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_004271.1 Gene:EEF1E1 / 9521 HGNCID:3212 Length:174 Species:Homo sapiens
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:142 Identity:37/142 - (26%)
Similarity:66/142 - (46%) Gaps:26/142 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    29 QIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYR--------------- 78
            ::|..:|..|..|:....||..|   ||::...|.....:|.||||:.:.               
  Fly    54 KVPAFETAEGQYLSESNAIAYLL---ANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPL 115

Human    79 ---VTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYG---LHRFIVDLTVQEKE 137
               :.|....::|.:...:|:.||..|:|..:|.|...|||||:::..   |:.::::.:|  :.
  Fly   116 LGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSV--RS 178

Human   138 KYLNVSRWFCHI 149
            .:.||:|||..|
  Fly   179 AFGNVNRWFVTI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1E1NP_004271.1 N-terminal 2..56 7/26 (27%)
Linker 57..63 0/5 (0%)
C-terminal 64..152 27/107 (25%)
GST_C_AIMP3 65..165 CDD:198338 27/106 (25%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 8/27 (30%)
GstA 5..187 CDD:223698 34/137 (25%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 27/103 (26%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.