DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1E1 and GstE4

DIOPT Version :9

Sequence 1:NP_004271.1 Gene:EEF1E1 / 9521 HGNCID:3212 Length:174 Species:Homo sapiens
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:170 Identity:36/170 - (21%)
Similarity:72/170 - (42%) Gaps:30/170 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     7 LSLLEK---SLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLV-KQANKEYLLGSTAEE 67
            ::|.||   |...||.|.     :..:|:||.::. .:.....|.|:|| |.|..:.|......:
  Fly    34 VNLFEKENFSEDFSKKNP-----QHTVPLLQDDDA-CIWDSHAIMAYLVEKYAPSDELYPKDLLQ 92

Human    68 KAIVQQWLEY-----------RVTQV-----DGHSSKNDIHTLLK---DLNSYLEDKVYLTGYNF 113
            :|.|.|.:.:           |:|:.     :....:|.:..:|:   .:.::|:|..::.|...
  Fly    93 RAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQL 157

Human   114 TLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYP 153
            |:||..:...:....|.|.: :..||..::.|...::..|
  Fly   158 TIADFSIVSTITSIGVFLEL-DPAKYPKIAAWLERLKELP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1E1NP_004271.1 N-terminal 2..56 15/52 (29%)
Linker 57..63 1/5 (20%)
C-terminal 64..152 18/106 (17%)
GST_C_AIMP3 65..165 CDD:198338 19/108 (18%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 13/48 (27%)
GstA 6..196 CDD:223698 35/168 (21%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.