DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1E1 and GstE13

DIOPT Version :9

Sequence 1:NP_004271.1 Gene:EEF1E1 / 9521 HGNCID:3212 Length:174 Species:Homo sapiens
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:141 Identity:32/141 - (22%)
Similarity:56/141 - (39%) Gaps:26/141 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    27 ERQIPVLQTNNGPSLTGLTTIAAHLV-KQANKEYLLGSTAEEKAIVQQWLEYR---VTQV----- 82
            :.||||...::|........|...|| |.|..:.|.....:.:|.:...:.|.   :.||     
  Fly    52 QHQIPVFVDSDGEVYVDSHAIVCFLVA
KYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIV 116

Human    83 -------DGHSSKNDI---HTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIV--DLTVQ- 134
                   :|..:...:   |....||..:|:...::.|...::||:    .:|..:|  ||.:. 
  Fly   117 ARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADV----SIHTTLVTLDLLIPV 177

Human   135 EKEKYLNVSRW 145
            |:|||....:|
  Fly   178 EREKYPQTKQW 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1E1NP_004271.1 N-terminal 2..56 9/29 (31%)
Linker 57..63 1/5 (20%)
C-terminal 64..152 21/103 (20%)
GST_C_AIMP3 65..165 CDD:198338 21/102 (21%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 7/25 (28%)
GST_C_Delta_Epsilon 92..211 CDD:198287 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.