DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDF15 and scw

DIOPT Version :9

Sequence 1:NP_004855.2 Gene:GDF15 / 9518 HGNCID:30142 Length:308 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:224 Identity:58/224 - (25%)
Similarity:94/224 - (41%) Gaps:43/224 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   121 HRALFRLSPTAS-RSW---DVTRPLRRQL---SLARPQAPALHLRLSPPPSQSDQLL-------A 171
            :|.|..::.|:| |.|   ::|..||..|   .|.|..    .||:|...||.....       |
  Fly   182 YRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRN----ELRISIGDSQLSTFAAGLVTPQA 242

Human   172 ESSSARPQL-------ELHLRPQAARGRR---RARARNGDHCP--------LGPGRCCRLHTVRA 218
            ..:|..|.:       ||.::.|..|.:|   :.||..|...|        ..|.:.|.......
  Fly   243 SRTSLEPFIVGY
FNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTV 307

Human   219 SLEDLGWADWVLSPREVQVTMCIGAC----PSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASY 279
            ..::|...:||::|::.:...|.|.|    .::..|.| ||.::|.:| ||...:|.|||||...
  Fly   308 DFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATN-HAIVQTLMH-LKQPHLPKPCCVPTVL 370

Human   280 NPMVLIQKTDTG-VSLQTYDDLLAKDCHC 307
            ..:.:::..:.. :.|..|...:||:|.|
  Fly   371 GAITILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDF15NP_004855.2 MscS_TM <23..>147 CDD:331130 10/32 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..177 7/31 (23%)
TGFB 211..308 CDD:214556 28/102 (27%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 20/75 (27%)
TGFB 300..400 CDD:214556 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.