DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCARB2 and CG10345

DIOPT Version :9

Sequence 1:NP_005497.1 Gene:SCARB2 / 950 HGNCID:1665 Length:478 Species:Homo sapiens
Sequence 2:NP_650563.2 Gene:CG10345 / 42017 FlyBaseID:FBgn0027562 Length:552 Species:Drosophila melanogaster


Alignment Length:439 Identity:121/439 - (27%)
Similarity:206/439 - (46%) Gaps:37/439 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     9 AGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPE 73
            :..|.:.||.....::::...|..:|..:.    |:.||.....|..|||.||...|.||.||.:
  Fly    17 SAALGMTLLFFGSLVIISDPLQSILDTQLS----LKPGTLLHRLWLLPPLDVYINVYMFNYTNVD 77

Human    74 EILRGETPR--VEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTL 136
            |...|...:  ::|||||.|:|:.:..|:.:.::..||:....:.|||..::||||||||.||..
  Fly    78 EFTSGRASKLQLQEVGPYVYKEVLSNHNVTYNESNNTITYSPKREYVFAPERSVGDPKIDRIRAP 142

Human   137 NIPVL--TVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGYKDEILSLIHVFRP---DIS 196
            |||::  |.:..|...|....:.|:.:....:..:..:|.:.:|||:|.::.|...|.|   |.|
  Fly   143 NIPLMGVTTLASSLSMFAALGLSAITRQLNSQPMLEMSVHDYMWGYEDHLVELASRFVPNWIDFS 207

Human   197 PYFG----LFYEKNGTNDGDYVFLTGEDSY-LNFT------KIVEWNGKTSLDWWITDK------ 244
            . ||    ||.|.|.:|..:......:|.| :..|      .:...||:.....|..::      
  Fly   208 S-FGIMEKLFREGNESNVFNMNLPEPKDKYGMRMTDAPRGYTVDSINGERGFKGWQYNEETNGTM 271

Human   245 CNMINGTDGDSFHPL-ITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDN 308
            ||.|.|:...:..|| :.:::..:::...|||.:.:.|:...:..||.||.:.:..:...:..||
  Fly   272 CNRIWGSHDATLFPLDMDENDEFFLYRRTFCRRLPVKFNRTTTFNGLDAFEFVMEPDSFDSEVDN 336

Human   309 AG---FCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPN-QEDHETFVDI 369
            |.   :| ....||..||.|||.|....|:.:::|||..||...:...:|:.|| .....||| :
  Fly   337 ANSSCYC-KNNRCLKKGVGNVSPCYYNIPLAITYPHFMHADPSLLEPFDGLQPNVSRFTSTFV-V 399

Human   370 NPLTGIILKAAK-RFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHI 417
            .|..|..::... |.|.|..|.|::..........|:.|:::::.::.:
  Fly   400 QPQLGAPMQGTHLRLQANQVVGKVNFNRMMTPFENMILPLLWVDLNIDV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCARB2NP_005497.1 CD36 28..455 CDD:307331 118/420 (28%)
Important for interaction with GBA 155..191 7/35 (20%)
CG10345NP_650563.2 CD36 21..488 CDD:279474 120/435 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11923
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X155
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.