DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYOT and vn

DIOPT Version :9

Sequence 1:NP_006781.1 Gene:MYOT / 9499 HGNCID:12399 Length:498 Species:Homo sapiens
Sequence 2:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster


Alignment Length:533 Identity:105/533 - (19%)
Similarity:192/533 - (36%) Gaps:137/533 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     5 ERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSSHITMSSSAF 69
            |...::|...:..||.......|:.|.||::..::|             .::.||..::::|::.
  Fly    64 EESSYYIPLSSDNGSGSSESSAESGSSSSRSSSNNI-------------DNNILSRLLSLNSNSL 115

Human    70 PASPQQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPI----- 129
            .:.      ||...:..|.::      ..|..|:|.:.:.:.:|.......||..:.|.:     
  Fly   116 SSR------SNVKLKPATVFD------AGSSTPAQQEQHVAAVPEQQQQQQQQQQSMQKVPNTLI 168

Human   130 ---------NAKPSQTANAK--------PIPRTPDHEIQ-----GSKEALIQDLERKLKCKDTLL 172
                     |..||:.|::|        .:|..|:...|     .|:.|:...|....:..:::|
  Fly   169 NSQIYNLLYNGMPSEAASSKMRRHIQPSQLPHQPESRAQLPSNYSSRPAVRSYLIESYEMPESML 233

Human   173 H-----------------NGN---------QRLTYEEKMARRLLGPQNAAAVFQAQDDSGAQDSQ 211
            .                 ||:         |:|..:::..||           |.||....|..|
  Fly   234 EDRSPEQAARSRRDGSNTNGSRQQQRTGHRQQLQQDKRDHRR-----------QRQDQQKEQRQQ 287

Human   212 QHNSEHA---RLQVPTSQVRSRSTSRGDVN----DQDAIQEKFYPPRFIQ-VPENMSIDEGRFCR 268
            |...:|.   :.|....|.|.........|    .:|..|..|..|...| |.::||.|.    |
  Fly   288 QQQRQHKSGNKHQQQQQQRRKHQRKHQRYNRYCSARDPAQLAFAAPTVFQGVFKSMSADR----R 348

Human   269 MDFKVS-----------GLPAPD---VSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAG 319
            ::|..:           .|..|.   :.:.|:..:.:. |:::..:..:|:.....::.:|||..
  Fly   349 VNFSATMKVEKVYKQQHDLQLPTLVRLQFALSNSSGEC-DIYRERLMPRGMLRSGNDLQQASDIS 412

Human   320 AYACVAKNRAGEATFTVQ------LDVLAKE---------HKRAPMFIYKPQSKKVLEGDSVKLE 369
            ....|.:...|..|...|      |.|.|.|         :........||....:..|..:::.
  Fly   413 YMMFVQQTNPGNFTILGQPMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIV 477

Human   370 CQISAIPPPKLFWKRNNEMVQFNTDRISLYQ--DNTGRVTLLIKDVN-KKDAGWYTVSAVNEAGV 431
            |::|..||||:.|.::.:.:  |..| ::||  .:..|..|:::..| ..|||.|...|.|:|..
  Fly   478 CEVSGQPPPKVTWFKDEKSI--NRKR-NIYQFKHHKRRSELIVRSFNSSSDAGRYECRAKNKASK 539

Human   432 TTCNTRLDVTARP 444
            .....|:.:.|.|
  Fly   540 AIAKRRIMIKASP 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYOTNP_006781.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 9/40 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..151 18/108 (17%)
Necessary for interaction with ACTN1 79..150 17/92 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..241 10/45 (22%)
Necessary for interaction with ACTA1. /evidence=ECO:0000269|PubMed:12499399 215..498 59/270 (22%)
Necessary for interaction with FLNC 215..493 59/270 (22%)
Ig 249..333 CDD:299845 18/98 (18%)
I-set 250..340 CDD:254352 21/110 (19%)
I-set 349..440 CDD:254352 25/93 (27%)
Ig_Myotilin_C 366..440 CDD:143300 22/76 (29%)
vnNP_523942.2 IGc2 471..538 CDD:197706 21/69 (30%)
EGF 566..598 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5483
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.