DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBX4 and tbx-37

DIOPT Version :9

Sequence 1:XP_011523792.1 Gene:TBX4 / 9496 HGNCID:11603 Length:609 Species:Homo sapiens
Sequence 2:NP_499444.2 Gene:tbx-37 / 189977 WormBaseID:WBGene00006556 Length:313 Species:Caenorhabditis elegans


Alignment Length:271 Identity:90/271 - (33%)
Similarity:128/271 - (47%) Gaps:32/271 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   130 IKVGLHEKELWKKFHEAGTEMIIT-KAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFC 193
            |:|.|::.|:|:||:.. ||||:| |.||.:||.....|.|::|.:.|.:.|.:...|..:|||.
 Worm    10 IEVSLNKPEIWEKFYPK-TEMIVTRKRGRVIFPHLDYNVKGLDPDSLYSIYIHLERVDGIKYKFD 73

Human   194 DNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGH----IILNSMHK 254
            ..:|..|||.:|.:|.:...||....||..||.:.|||..||:||   ||...    |:..|:||
 Worm    74 AGEWKEAGKGDPILPIQYKEHPRGKRTGTEWMSEPVSFAHLKITN---DPENKDQKLILAQSLHK 135

Human   255 YQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKITQLKIENNPFAKGFRGSDDSD 319
            |.|.|||.:.|........:..........|.||.||:|||.::|:||:.:|.||.|||.:....
 Worm   136 YIPVLHIKQLDPYKGTFQMDFHGVEFRLEATQFIVVTAYQNEELTKLKVHHNKFASGFRSNGKRR 200

Human   320 LRVARLQSKEYPVISKSIMRQRLISPQLS------------------ATPDV-GPLLGTHQA-LQ 364
            |......|:..|....:.....|..|.:|                  :||.. .|....|.| .|
 Worm   201 LSSESENSENSPPKRSASAISSLTPPAISPPMDYTQQNPYFFNQNFFSTPQSHQPQFAAHSANAQ 265

Human   365 HYQH---ENGA 372
            :|.:   :|||
 Worm   266 NYNNFGAQNGA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBX4XP_011523792.1 TBOX 129..318 CDD:238106 74/192 (39%)
tbx-37NP_499444.2 TBOX 9..199 CDD:238106 74/192 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161449202
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.