DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A27 and CG1907

DIOPT Version :9

Sequence 1:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:305 Identity:94/305 - (30%)
Similarity:156/305 - (51%) Gaps:28/305 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    20 ASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGF 84
            |.|||..|.:...|.:...||||.|||:|:.|      .|.|.:|   ||..:.....|:.:||.
  Fly    18 AIKFLFGGLSGMGATMVVQPLDLVKTRMQISG------AGSGKKE---YRSSLHCIQTIVSKEGP 73

Human    85 LKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLANPTD 149
            |.|:||:..|:.|...|:.||:..|.:|.: :|.:.......:..|:..|.:||..|.|:..|.:
  Fly    74 LALYQGIGAALLRQATYTTGRLGMYTYLND-LFREKFQRSPGITDSMAMGTIAGACGAFIGTPAE 137

Human   150 LVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTV 214
            :..|:|..:|:..: .:...:..|.:|.|:|..|.|:..||.|.:|.:.||.:|||..|.:|...
  Fly   138 VALVRMTSDGRLPV-AERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQF 201

Human   215 KHYLVLNTPL--EDNIMTHGLSSLCSGLVASILGTPADVIKSRIMN------QPRDKQGRGLLYK 271
            |.|. .:.||  |:.|..|..:|:.|||:.:|...|.|:.|:||.|      :|.        |:
  Fly   202 KTYF-RHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPE--------YR 257

Human   272 SSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIRE 316
            .:.|.|::..:.||..:|:|||.|.:.|:.|.:::.::..|::.:
  Fly   258 GTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 34/97 (35%)
Solcar 1 21..115 33/93 (35%)
Mito_carr 125..219 CDD:365909 29/93 (31%)
Solcar 2 125..217 28/91 (31%)
Solcar 3 226..317 27/97 (28%)
Mito_carr 227..317 CDD:365909 27/96 (28%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 35/100 (35%)
Mito_carr 118..207 CDD:278578 29/90 (32%)
Mito_carr 219..307 CDD:278578 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.