DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A27 and Bmcp

DIOPT Version :9

Sequence 1:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:307 Identity:111/307 - (36%)
Similarity:170/307 - (55%) Gaps:27/307 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    23 FLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKL 87
            |:..|.|:..||..|||:|.||||||:||:..     |.:.....||||....:.|..|||...|
  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKI-----DQSFSQLRYRGMTDAFVKISREEGLRAL 69

Human    88 WQGVTPAIYRHVVYSGGRMVTYEHLREVVFGK----SEDEHYPLWKSVIGGMMAGVIGQFLANPT 148
            :.|:.||:.|...|...:..||..|:::...:    :||....:|.:::....||.|...:||||
  Fly    70 YSGIWPAVLRQATYGTIKFGTYYTLKKL
ANERGLLINEDGSERVWSNILCAAAAGAISSAIANPT 134

Human   149 DLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDT 213
            |::||:||:.||.       :.:|:...|.:|....|:||||.|..|..|||.::...:|..||.
  Fly   135 DVLKVRMQVHGKG-------QHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDF 192

Human   214 VKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIMNQ-PRDKQGRGL--------L 269
            .|  |.|.....|::..|.:||..:.|.::|..||.|||::|:||| |......|:        |
  Fly   193 CK--LQLMN
AFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKL 255

Human   270 YKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIRE 316
            |..|.||.:|.::.||..:|||||:|:|:||.||:::|::|||::::
  Fly   256 YSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 35/94 (37%)
Solcar 1 21..115 35/91 (38%)
Mito_carr 125..219 CDD:365909 32/93 (34%)
Solcar 2 125..217 32/91 (35%)
Solcar 3 226..317 40/100 (40%)
Mito_carr 227..317 CDD:365909 39/99 (39%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 35/91 (38%)
Mito_carr <132..199 CDD:278578 29/75 (39%)
Mito_carr 204..303 CDD:278578 39/99 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.