DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A27 and CG18327

DIOPT Version :9

Sequence 1:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:300 Identity:96/300 - (32%)
Similarity:160/300 - (53%) Gaps:16/300 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    21 SKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL 85
            |.|:|.|.||..|.:.|.|:::.|||:|:|||  ||..|..|:   ||:.:.:..:.:.:.:|.|
  Fly     4 SDFVLGGVAAMGAGVFTNPVEVIKTRIQLQGE--LAARGSHAQ---PYKSVFQAFVTVAKNDGIL 63

Human    86 KLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLANPTDL 150
            .|.:|:.||:....|.:..|:..|.|..|..:..:........|.:..|.:.||:|.:.|:|..|
  Fly    64 GLQKGLAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFL 128

Human   151 VKVQMQMEGKRKLE-GKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTV 214
            :|.|:|.:..:::. |...:...:..|..||..:.|:.|||.|.:.|:.||.:.:...:..:...
  Fly   129 IKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQA 193

Human   215 KHYLVLNTPLEDNIMTH-GLSSLCSGLVA----SILGTPADVIKSRIMNQPRDKQGRGLLYKSST 274
            |..|     .|:.::|| .:.|.||||.|    |:..||.||:.:|:.||..|.||||:.|:...
  Fly   194 KSLL-----KENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWL 253

Human   275 DCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKI 314
            ||::..::.||...|||||.|.:||..|:|.:..|.::::
  Fly   254 DCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 33/96 (34%)
Solcar 1 21..115 32/93 (34%)
Mito_carr 125..219 CDD:365909 24/94 (26%)
Solcar 2 125..217 24/92 (26%)
Solcar 3 226..317 37/93 (40%)
Mito_carr 227..317 CDD:365909 37/92 (40%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 30/87 (34%)
PTZ00169 5..293 CDD:240302 95/297 (32%)
Mito_carr 101..201 CDD:278578 26/104 (25%)
Mito_carr 204..296 CDD:278578 37/89 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.