DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A27 and CG8323

DIOPT Version :9

Sequence 1:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:314 Identity:99/314 - (31%)
Similarity:163/314 - (51%) Gaps:44/314 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    21 SKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARES--APYRGMVRTALGIIEEEG 83
            |.|:|.|.|:..|...|.|:::.|||:|:|||.|       ||.:  .||:|:|...:.:.:.:|
  Fly     4 SDFVLGGLASVGATFFTNPIEVIKTRIQLQGELA-------ARGTYVEPYKGIVNAFITVAKNDG 61

Human    84 FLKLWQGVTPAIYRHVVYSGGRMVTYE--------HLR--EVVFGKSEDEHYPLWKSVIGGMMAG 138
            ...|.:|:.||:|...:.:..|:..|.        |.|  ||.:|..     .||     |.:.|
  Fly    62 ITGLQKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMG-----LLW-----GAIGG 116

Human   139 VIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVH----HAFAKILAEGGIRGLWAGWVPNIQR 199
            |:|.:.::|..|:|.|:|.:..:::   .:.::..|    .|..:|.:..|:||||.|.|..:.|
  Fly   117 VVGCYFSSPFFLIKTQLQSQAAKQI---AVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPR 178

Human   200 AALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVA----SILGTPADVIKSRIMNQP 260
            |||.:...:.|:...|..||    ..|.:....|:|..:||:|    |:..||.|||.:|:.||.
  Fly   179 AALGSGAQIATFGKTKALLV----QYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQG 239

Human   261 RDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKI 314
            .|.:||||||:...||.::.::.||...:||||..::||:.|.|.:..|.::::
  Fly   240 VDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 34/108 (31%)
Solcar 1 21..115 32/105 (30%)
Mito_carr 125..219 CDD:365909 27/97 (28%)
Solcar 2 125..217 27/95 (28%)
Solcar 3 226..317 35/93 (38%)
Mito_carr 227..317 CDD:365909 34/92 (37%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 29/89 (33%)
PTZ00169 5..293 CDD:240302 98/311 (32%)
Mito_carr 101..200 CDD:278578 32/115 (28%)
Mito_carr 206..301 CDD:278578 34/88 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.