DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CABP1 and Cam

DIOPT Version :9

Sequence 1:XP_016875724.1 Gene:CABP1 / 9478 HGNCID:1384 Length:405 Species:Homo sapiens
Sequence 2:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster


Alignment Length:141 Identity:57/141 - (40%)
Similarity:92/141 - (65%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   222 LRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDF 286
            |..|:|.|.:|||..||||.||.|..::||..||::|..|||.||.::..:::.:..|.:||.:|
  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69

Human   287 VELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDV 351
            :.:|..|:    .|....:|:|:|||.||.:|:|.||.:|||..|.. ||.::...:::|:||:.
  Fly    70 LTMMARKM----KDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTN-LGEKLTDEEVDEMIREA 129

Human   352 DLNGDGRVDFE 362
            |::|||:|::|
  Fly   130 DIDGDGQVNYE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CABP1XP_016875724.1 None
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 57/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.