DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED20 and MED20

DIOPT Version :9

Sequence 1:NP_004266.2 Gene:MED20 / 9477 HGNCID:16840 Length:212 Species:Homo sapiens
Sequence 2:NP_001260223.1 Gene:MED20 / 43952 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster


Alignment Length:221 Identity:85/221 - (38%)
Similarity:130/221 - (58%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYV 65
            ||||.:...|:.||||....::.|:::|..|||...|.|.|||||:  .::.....|..|:.::|
  Fly     1 MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETF--ISTPQPHNGAPGRAVHV 63

Human    66 MHNSEYPLSCFALFENGP----CLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKV 126
            :||||||.|.|::.:||.    .::||..||:||:|:...|.|.|.:|||:||.|::|.||::|:
  Fly    64 LHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDFVIKL 128

Human   127 GTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLG-SHTPGAPAVFG------------- 177
            |:|||....:||.:|:||..||:.:.||.::.|.||.||| :.....|:.|.             
  Fly   129 GSVTMMEHFKGILIEIEYKSCVILAYCWEMIREMLQGFLGIAVNKDFPSYFAPQTIMTAMGQQQL 193

Human   178 -NRHDAVYGPADTMVQYMELFNKIRK 202
             .:|:.::.|.||:.||:|.|...||
  Fly   194 HAKHNDIFEPMDTVKQYLEQFTNYRK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED20NP_004266.2 Med20 1..198 CDD:400779 82/215 (38%)
MED20NP_001260223.1 Med20 1..215 CDD:285776 85/221 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146976
Domainoid 1 1.000 157 1.000 Domainoid score I4171
eggNOG 1 0.900 - - E1_KOG4309
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3158
Inparanoid 1 1.050 161 1.000 Inparanoid score I4241
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112080at2759
OrthoFinder 1 1.000 - - FOG0007370
OrthoInspector 1 1.000 - - oto91795
orthoMCL 1 0.900 - - OOG6_104763
Panther 1 1.100 - - LDO PTHR12465
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.