DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ROCK2 and Nek2

DIOPT Version :9

Sequence 1:XP_005246247.1 Gene:ROCK2 / 9475 HGNCID:10252 Length:1417 Species:Homo sapiens
Sequence 2:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster


Alignment Length:622 Identity:158/622 - (25%)
Similarity:268/622 - (43%) Gaps:143/622 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    86 QMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSP 150
            |...:||:|:.|:|.|:||....||.|::.:::|.|.::..|:.:....|.. .|..::.....|
  Fly    13 QKTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALV-SEISVLRQLQHP 76

Human   151 WVVQLFYAF--QDDRYLYMVMEYMPGGDLVNLM-------SNYDVPEKWAKFYTAEVVLALDAIH 206
            .:||.::..  ::.:.:|:|||...||||..::       ..::.|..|...:  ::..||...|
  Fly    77 NIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLF--QLCRALQVCH 139

Human   207 SM----GLIHRDVKPDNMLLDKHGHLKLADFGTC--MKMDETGMVHCDTAVGTPDYISPEVLKSQ 265
            :.    .::|||:||.|:.||..|:.||.|||..  ::.|::   ...:.||||.|:|||::|.:
  Fly   140 NKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQS---FAASFVGTPHYMSPELVKGR 201

Human   266 GGDGFYGRECDWWSVGVFLYEMLVGDTPFYA---DSL-----VGTYSKIMDHKNSLCFPEDAEIS 322
            .    |.|:.|.|:||..:|||.....||..   |.|     .|.:|:|           .|..|
  Fly   202 K----YDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRI-----------PAIYS 251

Human   323 KHAKNLICAFL-TDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAA--PVVPELSSDI----- 379
            ...:.:|...| .|.|   .|.|:|.|.:||....      ||.|...  |::.:...|.     
  Fly   252 TDLQEIIAFMLAVDHE---QRPGIEVIIRHPLVVR------NISELDGKFPILVDSGEDFYTLPS 307

Human   380 DSSNFDDIEDDKGD--------VETFPIPKAFVGNQLPFIG-FT-------YY--------RENL 420
            .:..|:|.|:|...        .|.:...:.:...:|...| ||       :|        .:.|
  Fly   308 GARLFEDEEEDGVHPELSSTMFTEQYSFNEGYGQRRLSVTGVFTPDLRSELFYSAKRKIFPAKKL 372

Human   421 LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELE 485
            .||| ||..|  ||:..:..|.::::         |:.|.:.|::.||         :|..:|| 
  Fly   373 QLSD-PSLYE--SIRREERAEERQVE---------LAEERRRKKDQEQ---------QKRDQEL- 415

Human   486 EEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKRNQNS 550
                |:::..|       .:||.|:...|..:...|....:.:|      |:.:||:|:.|.|..
  Fly   416 ----LKEAPSS-------PRALTQNIFDEVLKTRLHAIRAQESL------LQQKLEELQTREQEL 463

Human   551 QISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNCLLE----- 610
            |::.::|..|:||:.|  .||:.|..|.: .|:..|......:..:|::   .|..|.:|     
  Fly   464 QLAEQRVQTLERQMQE--KLLQQEKHTCS-CRQPIAPPIPPRKPAKSHH---DDTYCTIELNETS 522

Human   611 --TAKLKL-----EKEFINLQS-ALESERRDRTHGSE 639
              .|||.|     .|....|:. ..:|.::..|:|.|
  Fly   523 PTVAKLNLATLPAPKSLNTLRKVTFKSPQKFVTYGIE 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ROCK2XP_005246247.1 STKc_ROCK2 39..417 CDD:270771 100/385 (26%)
S_TKc 92..354 CDD:214567 83/285 (29%)
SCP-1 412..1080 CDD:114219 62/257 (24%)
HR1_ROCK2 505..571 CDD:212028 18/65 (28%)
Rho_Binding 979..1046 CDD:286056
PH_ROCK 1151..1257 CDD:269948
C1 1261..1307 CDD:237996
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 84/286 (29%)
S_TKc 19..281 CDD:214567 83/285 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.