DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EIF4E2 and eIF4E4

DIOPT Version :9

Sequence 1:NP_004837.1 Gene:EIF4E2 / 9470 HGNCID:3293 Length:245 Species:Homo sapiens
Sequence 2:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster


Alignment Length:230 Identity:77/230 - (33%)
Similarity:125/230 - (54%) Gaps:26/230 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     1 MNNKFDALKDDDSGDHDQNEENSTQKDGE--KEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFW 63
            |:|..:.|.|..|   ..:|:..|..|.:  |..||            :|....:|||:..:|.|
  Fly    12 MDNGTETLADSPS---SSSEDLKTLSDMDIRKPVTE------------IVDLRLKHPLENTWTLW 61

Human    64 YSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDA 128
            |...     ..|:::|....:|.:|..||.||..|:|:.:|.::...||:.|||:||:|||||||
  Fly    62 YLEN-----DRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDA 121

Human   129 NKNGGKWIIRLRKGLAS---RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQ 190
            ||.||:|:|.:.:|..:   :.|.:::|.::||.|...||:||||:::|.:.:.||||.....::
  Fly   122 NKFGGRWVINMGRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWTANGHNE 186

Human   191 ATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPG 225
            .....|...||.:|.|||:. ::|:.|.|::...|
  Fly   187 LAVMEIGLKLRDLLVLPPHQ-LQYQLHKDTMCKQG 220

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
EIF4E2NP_004837.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 12/52 (23%)
EIF4EBP1/2/3 binding. /evidence=ECO:0000269|PubMed:17368478 54..57 2/2 (100%)
IF4E 55..214 CDD:396291 60/161 (37%)