DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL27RA and Nrg

DIOPT Version :9

Sequence 1:NP_004834.1 Gene:IL27RA / 9466 HGNCID:17290 Length:636 Species:Homo sapiens
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:640 Identity:130/640 - (20%)
Similarity:205/640 - (32%) Gaps:182/640 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    36 AGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMS 100
            ||...||.....|::.          |...|.::.....:.:.|...||||:|......|     
  Fly   495 AGKYTCYAQNKFGEIQ----------ADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNE----- 544

Human   101 DKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVL--I 163
                                                   :.||.||..:.|    |...:.:  .
  Fly   545 ---------------------------------------AHDDTLEIEIDW----WKDGQSIDFE 566

Human   164 CQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATG-YKVYGRCRMEKEEDLWGEWSPILSFQ 227
            .|..:.:..:.:.|:    .||          :||.:| |....|.|:::     ......|..|
  Fly   567 AQPRFVKTNDNSLTI----AKT----------MELDSGEYTCVARTRLDE-----ATARANLIVQ 612

Human   228 TPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPG----PCVQVSYKVWF--------WVGGRELSPE 280
            ..|:|||   ::|..|.....|   :.|:..|    |.:.  |.:.|        |....|..|.
  Fly   613 DVPNAPK---LTGITCQADKAE---IHWEQQGDNRSPILH--YTIQFNTSFTPASWDAAYEKVPN 669

Human   281 GITCCCSLIPSGAEWA----RVSAVNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTE---LL 338
            ..:   |.:...:.||    ||.|.|.....|.:..|..|......|.....:.:...||   |:
  Fly   670 TDS---SFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLV 731

Human   339 VTWQPGPGEPLEH-------VVDWARDGDPLEKLNWVRLPPGNLSALLPGNFTVG-----VPYRI 391
            ::|.|.|  .:||       .|.|.||   :....|..   .|:......|..:.     |.|.|
  Fly   732 ISWTPMP--EIEHNAPNFHYYVSWKRD---IPAAAWEN---NNIFDWRQNNIVIADQPTFVKYLI 788

Human   392 TVTAVSASGLA--SASSVWGFREELAPLVGPTLWRLQDAPPGTPA-IAWGEVPRHQLRGHLTHY- 452
            .|.|::..|.:  :|..|.|:..|..||..||.:.::.....|.. :||..|....:|||...| 
  Fly   789 KVVAINDRGESNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYK 853

Human   453 --TLCAQSGTSPSVCMNVSGNTQSVTLPDL-PWGPCELWVTASTIAGQGPPGPILRLHLPDNTLR 514
              |.....|......::|.|:|.:..:... |.......:.|......|||..::....|:.   
  Fly   854 IQTWTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEG--- 915

Human   515 WKVLPGILFLWGLFLLGCGLSLATSGRCYHLRHKVLPRWVWEKVPDPANSSSG-QPHMEQVPEAQ 578
               :|..:         .||.....|....:.|       |:|...|....:| :.:.|:|.|:.
  Fly   916 ---VPSPV---------QGLDAYPLGSSAFMLH-------WKKPLYPNGKLTGYKIYYEEVKESY 961

Human   579 PLGDLPILEVEEMEP----PPV----MESSQP-------AQATAPLDSGYEKHFL 618
                  :.|..|.:|    |.|    |...:|       ..||..:..|.| |::
  Fly   962 ------VGERREYDPHITDPRVTRMKMAGLKPNSKYRISITATTKMGEGSE-HYI 1009

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL27RANP_004834.1 FN3 128..228 CDD:238020 17/102 (17%)
WSXWS motif 217..221 0/3 (0%)
FN3 321..394 CDD:328772 19/87 (22%)
Box 1 motif 554..562 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..636 12/47 (26%)
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476
I-set 339..427 CDD:254352
Ig 354..427 CDD:299845
I-set 432..517 CDD:254352 7/31 (23%)
Ig 446..517 CDD:299845 7/31 (23%)
I-set 522..611 CDD:254352 24/155 (15%)
ig 525..609 CDD:278476 23/150 (15%)
FN3 613..707 CDD:238020 24/104 (23%)
FN3 716..807 CDD:238020 22/98 (22%)
fn3 817..905 CDD:278470 19/87 (22%)
FN3 917..1004 CDD:238020 21/108 (19%)
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.