DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HAND2 and HLH3B

DIOPT Version :9

Sequence 1:NP_068808.1 Gene:HAND2 / 9464 HGNCID:4808 Length:217 Species:Homo sapiens
Sequence 2:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster


Alignment Length:149 Identity:48/149 - (32%)
Similarity:70/149 - (46%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    24 AAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDHSHYGGVPPGAG 88
            |.|..:.::|..||..|     .|:..|         |.|.|....||..|.:.|  ||.....|
  Fly   107 ADANRSLSSSPRSHSRN-----GLLTAP---------ASSGSSVGGSGGGGGNGS--GGNASSGG 155

Human    89 PPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMD 153
            ..|:|....|::..| |.:||.|.|:::.||||||:.:|..|.|.||||.:.||.|..||..|..
  Fly   156 GSGVGATGGVRKVFT-NTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTG 219

Human   154 LLAKDDQNGEAEAFKAEIK 172
            :|....:...:...:|:::
  Fly   220 ILEWQQRQAPSHPIRAQME 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HAND2NP_068808.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 13/39 (33%)
bHLH_TS_HAND2 100..161 CDD:381477 26/60 (43%)
HLH3BNP_525055.1 HLH 171..222 CDD:197674 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.