DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC6 and side-II

DIOPT Version :9

Sequence 1:XP_011525835.1 Gene:SIGLEC6 / 946 HGNCID:10875 Length:464 Species:Homo sapiens
Sequence 2:NP_001014485.3 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster


Alignment Length:345 Identity:80/345 - (23%)
Similarity:135/345 - (39%) Gaps:82/345 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    43 EGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATND-PDEEVQEE-----------TRGRFHL 95
            ||..|.:||  |.|.|........||.:.|.:|:.:.| .|:|.:|:           :|.:||.
  Fly    61 EGKSVSLPC--PITEPLDNVYMVLWFRDNAGIPLYSFDVRDKESREQPRHWSAPEVFGSRAKFHF 123

Human    96 LWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSS-KLSVRVMALTHRPNI------SIP 153
            ...|    .:|.|   :|.|...|..|:.   .:...|.| :.::.|:.|..:|.|      .:.
  Fly   124 DSQP----ATLEI---KRHDQGIYRCRVD---FRTSQTQSFRFNLSV
IILPEQPIIMDRWGRQLN 178

Human   154 GT----LESGHPSNLTCSVPWVCEQGTP-PIFSWM-------SAAPTSLGPRTTQSSVLTITPRP 206
            ||    .:.|....:||.|    ..|.| |...|:       :....:.|. ..::.:|..:.:.
  Fly   179 GTQLGPKQEGDDIVITCRV----VGGRPQPQVRWLVNGLLVDNQNEHNSGD-VIENRLLWPSVQR 238

Human   207 QDHSTNLTCQVTFPGAGVTMERTIQLNVSWMLRRPPLSTPDAPQKVAISIFQGNSAAFKILQNTS 271
            .|.::..|||..........|::..|:    :...||                   ..|||:..|
  Fly   239 NDLNSVFTCQALNTQLDKPKEKSFILD----MHLKPL-------------------VVKILEPPS 280

Human   272 SLPVLEGQALRLLCDADGN-PPAHLSWFQGFPALNAT--PIS-NTGVLELPQVGSAEEG--DFTC 330
            |:  :..:...:.|::.|: |.|.::|::|...|..|  .|| |:...||..|.:.::.  ..||
  Fly   281 SM--IADRRYEVSCESSGSRPNAIITWYKGKRQLRRTKDDISKNSTRSELSFVPTTDDDGKSITC 343

Human   331 RAQHPLGSLQISLSLFVHWK 350
            ||::|..:   .|.|...||
  Fly   344 RAENPNVN---GLYLETMWK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC6XP_011525835.1 Ig 31..141 CDD:299845 28/110 (25%)
IG_like 36..141 CDD:214653 28/110 (25%)
Ig_3 147..218 CDD:290638 18/88 (20%)
I-set 265..347 CDD:254352 26/87 (30%)
Ig 277..347 CDD:299845 21/75 (28%)
side-IINP_001014485.3 IG_like 55..160 CDD:214653 28/110 (25%)
Ig 57..160 CDD:299845 28/110 (25%)
Ig 188..251 CDD:299845 14/67 (21%)
Ig 289..363 CDD:299845 23/75 (31%)
IG_like 289..351 CDD:214653 19/61 (31%)
Ig_2 376..460 CDD:290606
IG_like 383..454 CDD:214653
Ig 470..548 CDD:299845
IG_like 481..557 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.