DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC6 and wrk-1

DIOPT Version :9

Sequence 1:XP_011525835.1 Gene:SIGLEC6 / 946 HGNCID:10875 Length:464 Species:Homo sapiens
Sequence 2:NP_001024651.1 Gene:wrk-1 / 181093 WormBaseID:WBGene00006942 Length:452 Species:Caenorhabditis elegans


Alignment Length:383 Identity:87/383 - (22%)
Similarity:137/383 - (35%) Gaps:98/383 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    11 EMLPLLLPLLWAGALAQERR-----FQLEGPESLTVQ---EGLCVLVPCRLPTTLPA-------S 60
            :::.|:|.||.|...||.|.     ...|| ||||::   |...|.:..|..|.:.|       :
 Worm     3 KLVLLILGLLIASTSAQIRTKGGTLIAKEG-ESLTLRCEVEDPSVAIIWRKNTEVVAVDDEILDT 66

Human    61 YYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKS 125
            |.||.. .:||: ..|.|....|.:            :....:|:|:      ....:..|.:|.
 Worm    67 YGGYEI-SMEGS-TSVLTIKRVEPI------------NSANYSCALA------EPEVSVTFVIKV 111

Human   126 KWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTP-PIFSWMSAA--- 186
            :..|    .:::||:.:.:. .|:..:...........:||.|    ::|.| |...|...|   
 Worm   112 QVFK----PTQVSVKPLVVI-SPDTGVYHARVGEKNLVITCHV----KEGNPKPGVVWTKQAAKL 167

Human   187 PTSLGPRTTQSSVLTITPRPQDHSTNLTCQV-TFPGAGVTMERTIQLNVSWMLRRPPLSTPDAPQ 250
            |..: .|....:.:.||...:.|:....|.. ...|:.   ..||.::|:     .||       
 Worm   168 PEDI-KREHGGARIVITEVKKHHAGKYNCLAENIAGSD---RATIDIHVA-----EPL------- 216

Human   251 KVAISIFQGNSAAFKILQNTSS-LPVLEGQALRLLCDADGNPPAHLSW-FQGFPA-LNATPISNT 312
                   ||.......::|..: :||.:.|.....|..||.|...:.| |.|:.. .|......|
 Worm   217 -------QGEREEKPWVKNEDTFIPVRKNQNASFWCTYDGTPVPQVEWLFNGYKINFNDEKFKKT 274

Human   313 GVLELPQ-----------VGSAEE---GDFTCRAQHPLGSLQISLSLFVHWKPEGRAG 356
            .  |..|           ||...|   ||:.||..:.||    |::..||  ..||.|
 Worm   275 S--ETAQRLNGYSKSTLTVGDISEEAFGDYACRISNKLG----SVTAVVH--VSGRPG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC6XP_011525835.1 Ig 31..141 CDD:299845 26/119 (22%)
IG_like 36..141 CDD:214653 24/114 (21%)
Ig_3 147..218 CDD:290638 15/75 (20%)
I-set 265..347 CDD:254352 25/98 (26%)
Ig 277..347 CDD:299845 22/85 (26%)
wrk-1NP_001024651.1 IG_like 25..113 CDD:214653 23/108 (21%)
IGc2 31..96 CDD:197706 19/79 (24%)
IG_like 132..212 CDD:214653 17/87 (20%)
IGc2 142..202 CDD:197706 14/64 (22%)
IG_like 235..320 CDD:214653 25/92 (27%)
Ig 245..318 CDD:143165 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.