DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC6 and LOC101884840

DIOPT Version :9

Sequence 1:XP_011525835.1 Gene:SIGLEC6 / 946 HGNCID:10875 Length:464 Species:Homo sapiens
Sequence 2:XP_021322151.1 Gene:LOC101884840 / 101884840 -ID:- Length:692 Species:Danio rerio


Alignment Length:303 Identity:71/303 - (23%)
Similarity:113/303 - (37%) Gaps:61/303 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    36 PESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATN--------DPDEEVQEETRGR 92
            || :|.....||::||.         :...:.:|.|..|....|        || .:|.:..:||
Zfish   333 PE-ITALPRSCVVIPCS---------FSVEHKYLTGLRVRWVNNNGGYMYHTDP-VDVLDNFKGR 386

Human    93 FHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNI-SIPGTL 156
            ..||.:|..:||:|.:.|.|..||..:.|:.:.|..||.:.:|.:.:.:.|...:|.: |:|..:
Zfish   387 TRLLGNPDERNCTLEMDDVRTHDNGPFCFQAEKKEEKYSFNNSCVFIIMRASPDQPVMSSVPEDI 451

Human   157 ESGHPSNLTCSVPWVCEQGTPPIFSW--------MSAAPTSLGPRTTQSSVLTITPRPQDHSTNL 213
            |.|....:.|||...| ...||..:|        :|..|...|...|.|.:..| |...:....:
Zfish   452 EPGTAVTVKCSVKHTC-SSHPPKITWSVPTVRETISHNPMGGGVWETVSKMKFI-PTGYEEEDEI 514

Human   214 TCQVTFPGAGVTMERTIQLNVSWM--LRRPPLSTPDAPQKVAISIFQG----------------- 259
            .|...|.|.......:..|:|..:  :...|.....:...|.|.|..|                 
Zfish   515 ICSANFWGGKTQSNSSAPLSVKRIQAVESGPYIIASSLVFVLICILAGVFMYKRHQRQPCEDITR 579

Human   260 ---NSAAFKILQNTSSLPVLEGQALRL-------LCDADGNPP 292
               ..:.:....:..|:|  ||:|...       :.||.|.||
Zfish   580 SEQRRSVWNRFSSRFSMP--EGRAAWFNSGNRSDIRDAPGRPP 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC6XP_011525835.1 Ig 31..141 CDD:299845 31/112 (28%)
IG_like 36..141 CDD:214653 31/112 (28%)
Ig_3 147..218 CDD:290638 20/79 (25%)
I-set 265..347 CDD:254352 10/35 (29%)
Ig 277..347 CDD:299845 8/23 (35%)
LOC101884840XP_021322151.1 Ig 1..>83 CDD:325142
Ig 226..307 CDD:325142
Ig 335..426 CDD:325142 28/100 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I12412
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.