| Sequence 1: | NP_004263.1 | Gene: | HOMER1 / 9456 | HGNCID: | 17512 | Length: | 354 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001379405.1 | Gene: | F55C10.5 / 3564818 | WormBaseID: | WBGene00010109 | Length: | 112 | Species: | Caenorhabditis elegans |
| Alignment Length: | 39 | Identity: | 10/39 - (25%) |
|---|---|---|---|
| Similarity: | 18/39 - (46%) | Gaps: | 4/39 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Human 63 ELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAAD 101 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| HOMER1 | NP_004263.1 | EVH1_Homer_Vesl | 3..111 | CDD:269917 | 10/39 (26%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 114..173 | ||||
| Smc | <181..>352 | CDD:440809 | |||
| Required for tetramerization. /evidence=ECO:0000250|UniProtKB:Q9Z214 | 290..354 | ||||
| F55C10.5 | NP_001379405.1 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||