DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOMER1 and myo2

DIOPT Version :9

Sequence 1:NP_004263.1 Gene:HOMER1 / 9456 HGNCID:17512 Length:354 Species:Homo sapiens
Sequence 2:NP_588114.1 Gene:myo2 / 2539513 PomBaseID:SPCC645.05c Length:1526 Species:Schizosaccharomyces pombe


Alignment Length:293 Identity:76/293 - (25%)
Similarity:138/293 - (47%) Gaps:50/293 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    92 SEHHLSKFAEKFQEFK-EAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPD 155
            ::..|.|...:..|.| |..:....||:.:.:|..|.:..:|   :::.||.|.....|.|   :
pombe   822 NDKQLKKRDAEIIELKYELKKQQNSKSEVERDLVETNNSLTA---VENLLTTERAIALDKE---E 880

Human   156 VTQNSEPRAEPTQNALPFSHSSAISKHWEAELATLKGNNAKLTAALLESTANVK-------QWKQ 213
            :.:.::.|....:::  ||.:...:::.:.|.|:||..|.:|.:.|||.|:.|:       :.|:
pombe   881 ILRRTQERLANIEDS--FSETKQQNENLQRESASLKQINNELESELLEKTSKVETLLSEQNELKE 943

Human   214 QLAAYQEEAERLHKRVTELECVSSQANAVHTHKTELNQTIQELEETLKLKEEEIERLKQEI-DNA 277
            :|:.  ||.:.|..: .|||.:......|.:.|.|.|:..:.|:||:..|:.|:::|.:.| |..
pombe   944 KLSL--EEKDLLDTK-GELESLRENNATVLSEKAEFNEQCKSLQETIVTKDAELDKLTKYISDYK 1005

Human   278 RELQEQRDSLT-QKLQEVEIRNKDLEGQLSDLEQRLEKSQNE----------------------- 318
            .|:||.|  || ||:.|..|:.   ||.||:..:|::|.:.|                       
pombe  1006 TEIQEMR--LTNQKMNEKSIQQ---EGSLSESLKRVKKLERENSTLISDVSILKQQKEELSVLKG 1065

Human   319 -QEAFRNNLKTLLEILDGKIFELTELRDNLAKL 350
             ||...|||:..:..|:..:.:|.:|:..|..|
pombe  1066 VQELTINNLEEKVNYLEADVKQLPKLKKELESL 1098

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOMER1NP_004263.1 EVH1_Homer_Vesl 3..111 CDD:269917 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..173 11/58 (19%)
SMC_N <157..>352 CDD:330553 61/227 (27%)
Required for tetramerization. /evidence=ECO:0000250|UniProtKB:Q9Z214 290..354 20/85 (24%)
myo2NP_588114.1 COG5022 6..1516 CDD:227355 76/293 (26%)
Myosin_N 25..>48 CDD:280832
MYSc_class_II 91..743 CDD:276951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.