DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOMER1 and F14H3.12

DIOPT Version :10

Sequence 1:NP_004263.1 Gene:HOMER1 / 9456 HGNCID:17512 Length:354 Species:Homo sapiens
Sequence 2:NP_507047.2 Gene:F14H3.12 / 184497 WormBaseID:WBGene00008831 Length:142 Species:Caenorhabditis elegans


Alignment Length:80 Identity:18/80 - (22%)
Similarity:30/80 - (37%) Gaps:19/80 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   251 QTIQELEETL-----KLKEEEIERLKQEIDNARELQEQRDSL-----------TQKLQEVEIR-- 297
            :.::|.:|.:     :...|.:..::|....|.|..:|.|..           |..|:..||.  
 Worm     3 EPVEECDENVGAFQWQQASETLTAIRQRFGFALETADQEDQARAVRFTWSLKKTSMLEPDEILKE 67

Human   298 -NKDLEGQLSDLEQR 311
             .|.||....|.||:
 Worm    68 IQKVLESYGIDYEQQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOMER1NP_004263.1 EVH1_Homer_Vesl 3..111 CDD:269917
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..173
Smc <181..>352 CDD:440809 18/80 (23%)
Required for tetramerization. /evidence=ECO:0000250|UniProtKB:Q9Z214 290..354 9/25 (36%)
F14H3.12NP_507047.2 AMPKA_C_like 45..140 CDD:473060 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.