DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOMER2 and F55C10.5

DIOPT Version :10

Sequence 1:XP_006720838.1 Gene:HOMER2 / 9455 HGNCID:17513 Length:364 Species:Homo sapiens
Sequence 2:NP_001379405.1 Gene:F55C10.5 / 3564818 WormBaseID:WBGene00010109 Length:112 Species:Caenorhabditis elegans


Alignment Length:102 Identity:20/102 - (19%)
Similarity:40/102 - (39%) Gaps:20/102 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   160 EKASHAGPANTHLKSEN-------DKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAAS 217
            ||.:..|.:.:.::..:       .|.::||.:....|:.| ||.:..:..|...|..:......
 Worm     5 EKHARFGDSKSRMEDRSRVLTMKYGKHQMALIRKRMKVENW-IETEVTKLFNGNETNNVDIDLDV 68

Human   218 VEQ-----WKRQFSI-------CRDENDRLRNKIDEL 242
            ::.     .||:|:.       |....|::...:|||
 Worm    69 IQDIEDVTGKRKFAFEQLQKAHCPCSMDKIIMFLDEL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOMER2XP_006720838.1 EVH1_Homer_Vesl 13..121 CDD:269917
SMC_prok_B <103..343 CDD:274008 20/102 (20%)
F55C10.5NP_001379405.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.