DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOMER2 and LOC100330028

DIOPT Version :9

Sequence 1:XP_006720838.1 Gene:HOMER2 / 9455 HGNCID:17513 Length:364 Species:Homo sapiens
Sequence 2:XP_021324005.1 Gene:LOC100330028 / 100330028 -ID:- Length:246 Species:Danio rerio


Alignment Length:245 Identity:135/245 - (55%)
Similarity:183/245 - (74%) Gaps:11/245 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     4 MMEVYKEPREQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIIN 68
            |.:.::| ||||||::|||||||||.||:||:||||.|||||:|||..|::||||||.|.|.|||
Zfish     1 MFQTHRE-REQPIFSSRAHVFQIDPATKRNWIPASKHAVTVSFFYDANRHAYRIISVGGTKAIIN 64

Human    69 STITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIET 133
            |||:|||||||||||||||||||||||:||||::||||.:|||:|:||||||::|::|:|:|:|.
Zfish    65 STISPNMTFTKTSQKFGQWADSRANTVYGLGFATEQQLHQFAERFREVKEAARLAREKSQDKMEL 129

Human   134 SS--------NHSQESGRETPSSTQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANV 190
            |:        ..||:...|. .|.....|||.|| |...:..|:..|.||.:::|..|::.:...
Zfish   130 STAALSIAAPQFSQDLSDEL-QSPPVMCVNGPDD-KLFRSQSADITLSSEKERIKKMLSEGSICE 192

Human   191 KKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKID 240
            ...|:||.||::|||:|..||.|:.|:|||||:|.:..::|.:|||:::|
Zfish   193 MNLEVELFTLQDSNAKLVAALHEANANVEQWKKQLAAYQEETERLRDQVD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOMER2XP_006720838.1 EVH1_Homer_Vesl 13..121 CDD:269917 85/107 (79%)
SMC_N <103..343 CDD:330553 60/146 (41%)
LOC100330028XP_021324005.1 EVH1_Homer_Vesl 9..117 CDD:269917 85/107 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251658at2759
OrthoFinder 1 1.000 - - FOG0004784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106337
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.