DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOMER2 and homer1

DIOPT Version :9

Sequence 1:XP_006720838.1 Gene:HOMER2 / 9455 HGNCID:17513 Length:364 Species:Homo sapiens
Sequence 2:NP_001106603.1 Gene:homer1 / 100127824 XenbaseID:XB-GENE-5807410 Length:355 Species:Xenopus tropicalis


Alignment Length:349 Identity:185/349 - (53%)
Similarity:254/349 - (72%) Gaps:1/349 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    13 EQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTF 77
            |||||:||||||||||||||||:|.||.|||||||||.|||.|||||:||:|.||||||:|||||
 Frog     3 EQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTISPNMTF 67

Human    78 TKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQES- 141
            ||||||||||||||||||:|||||||..||||||||||.||||::||:|:|||:|.:|..|||| 
 Frog    68 TKTSQKFGQWADSRANTVYGLGFSSEHHLTKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESA 132

Human   142 GRETPSSTQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNAR 206
            |.:..|.....|:||||||:.:.....|:..::|..:..:..|.|:|..|.||.||.||:.:||:
 Frog   133 GGDLQSPLTPESINGTDDERTTPDVTPNSEPRAEPTQNALPFTHSSAINKHWEAELATLKGNNAK 197

Human   207 LTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELR 271
            ||.||.||.|:|:|||:|.:..::|.:||..::.|||...::.|..:...|:|.::|:|||..|:
 Frog   198 LTAALLESTANVKQWKQQLAAYQEEAERLHKRVSELECLSNQANAVQSHKTELNQKIQELETTLK 262

Human   272 EKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVEL 336
            :||.|::.|:::.|...:|..:.:.:|:||:..|..|:::|.::..|:..:|:|:..|...:..|
 Frog   263 KKEEEIERLKEEVEHAKELQDQKDSLSQKLQEVETHNKDMEGQLSDLEQRLEKSQNEQDAFRNNL 327

Human   337 KSFLEVLDGKIDDLHDFRRGLSKL 360
            |:.||:|||||.:|.:.|..|:||
 Frog   328 KTLLEILDGKIFELTELRDNLAKL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOMER2XP_006720838.1 EVH1_Homer_Vesl 13..121 CDD:269917 93/107 (87%)
SMC_N <103..343 CDD:330553 96/240 (40%)
homer1NP_001106603.1 EVH1_Homer_Vesl 3..111 CDD:269917 93/107 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48606
OrthoDB 1 1.010 - - D1251658at2759
OrthoFinder 1 1.000 - - FOG0004784
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7014
SonicParanoid 1 1.000 - - X1808
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.