DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOMER3 and PRR1

DIOPT Version :10

Sequence 1:NP_004829.3 Gene:HOMER3 / 9454 HGNCID:17514 Length:361 Species:Homo sapiens
Sequence 2:NP_012806.1 Gene:PRR1 / 853744 SGDID:S000001599 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:62 Identity:15/62 - (24%)
Similarity:25/62 - (40%) Gaps:2/62 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   243 TPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTG--GPREALEAAEREETQQKVQDLET 302
            ||..::||.......:..:||:....:|.:.:.|..|  |...:........|.:.||.|.|
Yeast    13 TPRLKQEGFPDSIGDQHEKALIDENGEEDKKMASTEGTTGDSRSTPLTVSIPTFENVQALPT 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOMER3NP_004829.3 Required for interaction with NFATC2. /evidence=ECO:0000269|PubMed:18218901 1..80
EVH1_Homer_Vesl 6..114 CDD:269917
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..169
Smc <166..>360 CDD:440809 15/62 (24%)
PRR1NP_012806.1 S_TKc 192..508 CDD:214567
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.