DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GGPS1 and dlp1

DIOPT Version :9

Sequence 1:NP_001032354.1 Gene:GGPS1 / 9453 HGNCID:4249 Length:300 Species:Homo sapiens
Sequence 2:NP_594427.1 Gene:dlp1 / 2542608 PomBaseID:SPAC19G12.12 Length:294 Species:Schizosaccharomyces pombe


Alignment Length:197 Identity:47/197 - (23%)
Similarity:68/197 - (34%) Gaps:50/197 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    76 FPVAHSIYGIPSVINSANYVYFLGLEK-------------VLTLD---HPDAVKLFTRQLLELHQ 124
            ||.| |:...||.|:|     .|.|:|             ||:.|   |.|.:|:.|.::..|: 
pombe     3 FPFA-SLLKRPSAISS-----LLSLKKPGSWSSILLKAVGVLSRDSRWHSDLLKMLTEEMDSLN- 60

Human   125 GQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLM------------QLFSDYKEDLKPLL 177
              |....|.||... .:|..|......|.....|.|.||            |||..||:    |.
pombe    61 --GQINTWTDNNPL-LDEITKPYRKSSTRFFHPLLVLLMSRASVNGDPPSQQLFQRYKQ----LA 118

Human   178 NTLGLFFQIRDDYANLHSKEYSEN---KSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTE 239
            ....|.......:.|:..::.:|.   .:...|...||.|....|.     |:..:..|:.....
pombe   119 RVTELIHAANIIHINIGEEQSNEQIKLATLVGDYLLGKASVDLAHL-----ENNAITEIMASVIA 178

Human   240 NI 241
            |:
pombe   179 NL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GGPS1NP_001032354.1 polyprenyl_synt 9..251 CDD:395277 47/197 (24%)
dlp1NP_594427.1 IspA 2..294 CDD:223220 47/197 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.