DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GGPS1 and spo9

DIOPT Version :9

Sequence 1:NP_001032354.1 Gene:GGPS1 / 9453 HGNCID:4249 Length:300 Species:Homo sapiens
Sequence 2:NP_595334.1 Gene:spo9 / 2540933 PomBaseID:SPBC36.06c Length:351 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:62/267 - (23%)
Similarity:99/267 - (37%) Gaps:58/267 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    24 GKQVRTKLSQAFNHWLKVPEDKLQIIIE-VTEMLHNASLLIDDIEDNSKLRRGFPVAHSIYGIPS 87
            |..|...|:...|..|:..|.:...::. :.|:|....|:.|||.|.|..|||....:.:.|:..
pombe    59 GLAVLQSLTSLINRELEEAEFRDAALLGWLIEILQGCFLMADDIMDQSIKRRGLDCWYLVVGVRR 123

Human    88 VINSA----------------NYVYFLGLEKVLTLDHPDAVKLFT-----RQLLELHQGQ----G 127
            .||.:                |..|::.|     ||....|...|     ..||....|:    .
pombe   124 AINESQLLEACIPLLIRKYFRNMPYYVDL-----LDTFREVTFLTELGQQEDLLSSRDGEASLRS 183

Human   128 LDIYWRDNYTCPTEEEYKAMVLQKTGGL-FGLAVGLMQLFS------DYKEDLKPLLNTLGLFFQ 185
            .|:.           :|..::..||... |.|.:....|.|      .|...:| |...||.:||
pombe   184 FDLM-----------KYDFIITYKTSFYSFYLPIKCALLLSRNSNQKAYDTTIK-LSKLLGYYFQ 236

Human   186 IRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQR-----TENIDIKK 245
            ::|||.:... :|:.......|:.:.|.::...:|  .:..|....|:||..     :|||.:.|
pombe   237 VQDDYLDCFG-DYTVLGKVGMDIQDNKCTWLVCYA--EKFASADQLNLLRAHYGKAGSENIAVIK 298

Human   246 YCVHYLE 252
            ...|.|:
pombe   299 QLYHELQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GGPS1NP_001032354.1 polyprenyl_synt 9..251 CDD:395277 61/264 (23%)
spo9NP_595334.1 polyprenyl_synt 52..308 CDD:278763 62/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.