DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD33 and side-VI

DIOPT Version :10

Sequence 1:XP_011525833.1 Gene:CD33 / 945 HGNCID:1659 Length:418 Species:Homo sapiens
Sequence 2:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster


Alignment Length:364 Identity:70/364 - (19%)
Similarity:109/364 - (29%) Gaps:148/364 - (40%)


- Green bases have known domain annotations that are detailed below.


Human   101 IPYYDKNSPVHGY------------WFREGAIISRDSPVATNKLDQE-----VQEETQGRFRL-- 146
            :.:|..|.|::.|            | |:..::...:...|:|...|     |:|:..|.||.  
  Fly    61 VVWYKNNLPIYSYDTRGAHAGTPSHW-RDEEVLEDRAVFRTHKEPAELIINPVKEKDAGNFRCRV 124

Human   147 ---LGDPSRNNCSLSIV----------------DARRRDNGSYFFRMERGSTK-----YSYKSP- 186
               |.....:|.:|.:|                |:|.   |.|   .|.||.:     |....| 
  Fly   125 DFKLSQTRNSNVNLEVVVPPTQPIIFNERRLRIDSRA---GPY---EEGGSLEVTCVVYGGSPPP 183

Human   187 --------QLSVHVTDLTHRPKI---LIPGTLEPGHSKNL-TCSVS------------------- 220
                    ||...|.|.|:...|   |:...|...|...: ||..|                   
  Fly   184 TVIWLMNGQLQNSVVDYTYDGAINSKLVVRNLSRIHQHAVYTCQASN
FHKKYVATNITIDLYLRP 248

Human   221 ----------------------WACEQGTPPIFSWLSAAPTSLGPRTTH-------------SSV 250
                                  .|.....|...:|.      :|....|             :||
  Fly   249 LLVEISFNNQPMSADRKYEIECQAIGSRPPAKITWW------MGNLELHGHSQKVSEDGNVSTSV 307

Human   251 LIITPRPQDHGTNLTCQV--KFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH 313
            |.|||..:|||..|:|:.  :....|: .|..::|||.::   ||..:..|.....::...|.. 
  Fly   308 LSITPTREDHGKALSCRATNELVRNGI-RETAMKLNVFFI---PTLQLDLGSNLNPEDIEEGDD- 367

Human   314 GAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRND 352
                              ::|..|.|...||...|.:::
  Fly   368 ------------------VYFECKVHANPAAYKVVWKHN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD33XP_011525833.1 IgV_CD33 75..193 CDD:409377 29/143 (20%)
FR1 75..99 CDD:409377
Ig strand A 75..79 CDD:409377
Ig strand A' 82..86 CDD:409377
Ig strand B 88..99 CDD:409377
CDR1 100..109 CDD:409377 2/7 (29%)
FR2 110..117 CDD:409377 2/18 (11%)
Ig strand C 110..117 CDD:409377 2/18 (11%)
CDR2 118..141 CDD:409377 5/27 (19%)
Ig strand C' 128..131 CDD:409377 1/2 (50%)
FR3 142..175 CDD:409377 11/53 (21%)
Ig strand D 143..147 CDD:409377 2/8 (25%)
Ig strand E 153..161 CDD:409377 3/23 (13%)
Ig strand F 168..176 CDD:409377 2/7 (29%)
CDR3 176..179 CDD:409377 1/2 (50%)
FR4 180..193 CDD:409377 4/26 (15%)
Ig strand G 180..193 CDD:409377 4/26 (15%)
IgC2_CD33_d2_like 199..284 CDD:409579 25/144 (17%)
Ig strand A 199..203 CDD:409579 1/6 (17%)
Ig strand B 212..218 CDD:409579 1/6 (17%)
Ig strand C 230..235 CDD:409579 1/4 (25%)
Ig strand E 249..255 CDD:409579 4/5 (80%)
Ig strand F 262..269 CDD:409579 2/8 (25%)
Ig strand G 276..284 CDD:409579 1/7 (14%)
side-VINP_001036705.1 IG_like 35..140 CDD:214653 17/79 (22%)
Ig_3 165..230 CDD:464046 16/64 (25%)
Ig 262..343 CDD:472250 19/87 (22%)
Ig strand B 266..270 CDD:409416 0/3 (0%)
Ig strand C 280..284 CDD:409416 0/3 (0%)
Ig strand F 320..325 CDD:409416 2/4 (50%)
Ig strand G 336..339 CDD:409416 1/2 (50%)
Ig_3 358..426 CDD:464046 7/50 (14%)
Ig_3 456..524 CDD:464046
FN3 545..622 CDD:473895
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.