DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD33 and igcm-4

DIOPT Version :9

Sequence 1:XP_011525833.1 Gene:CD33 / 945 HGNCID:1659 Length:418 Species:Homo sapiens
Sequence 2:NP_508377.1 Gene:igcm-4 / 180518 WormBaseID:WBGene00022418 Length:541 Species:Caenorhabditis elegans


Alignment Length:175 Identity:36/175 - (20%)
Similarity:56/175 - (32%) Gaps:44/175 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   127 VATNKLDQEVQEETQG-------RFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYK 184
            :||.|....:|....|       :::|    |:::..|.:...:..|:|.|..:...|   :.:|
 Worm    59 IATEKDSTMIQWSKNGEQLDWDSQYKL----SKDSKELKMKSVKFEDSGRYQCQATNG---FGHK 116

Human   185 SPQLSVHVTD----------------LTHRPKILI--------PGTLEPGHSKNLTCSVSWACEQ 225
            :.:..|||.|                .|..|..||        |..:..|....|.|..     |
 Worm   117 TIEFIVHVHDQHDKENSVKDYLVLSNTTASPSWLIDMNSEWRSPIKINTGGKLELRCPA-----Q 176

Human   226 GTP-PIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVK 269
            |.| |...|.............|.|.:.:.|....|.....|.|:
 Worm   177 GNPLPEIRWYQNEMEISEKTHKHVSTITVEPVESSHSGVYRCVVE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD33XP_011525833.1 Ig 77..193 CDD:299845 15/72 (21%)
IG_like 80..182 CDD:214653 12/61 (20%)
ig 200..281 CDD:278476 17/79 (22%)
igcm-4NP_508377.1 IGc2 52..114 CDD:197706 12/61 (20%)
I-set 159..235 CDD:254352 15/68 (22%)
IGc2 166..225 CDD:197706 14/61 (23%)
IG_like 261..373 CDD:214653
Ig 269..374 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.