DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD33 and LOC108179236

DIOPT Version :9

Sequence 1:XP_011525833.1 Gene:CD33 / 945 HGNCID:1659 Length:418 Species:Homo sapiens
Sequence 2:XP_021322205.1 Gene:LOC108179236 / 108179236 -ID:- Length:249 Species:Danio rerio


Alignment Length:279 Identity:67/279 - (24%)
Similarity:119/279 - (42%) Gaps:50/279 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    83 VTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWF-REGAIISRDSPVATNKLDQEVQEETQGRFRL 146
            :|.....||::||:|   .|..:..:.:...|. ::|..:....||       :|.:..:||.:|
Zfish     8 ITALPRSCVVIPCSF---TPEDEHLTRLRVRWVNKKGGYMYHTDPV-------DVLDNFKGRTKL 62

Human   147 LGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKIL-IPGTLEPG 210
            ||||...||:|.:.|.|..|||.:.|:.|:...|||:.:..:.:.:......|.|. :|..::||
Zfish    63 LGDPDEQNCTLEMDDVRTHDNGPFCFQAEKKEEKYSFNNSCVFIIMRKTPDTPVISPLPNDIKPG 127

Human   211 HSKNLTCSVSWACEQGTPPIFSW--------LSAAPTSLGPRTTHSSV-LIITPRPQDHGTNLTC 266
            .:..:.|||...| ...||...|        :|..|...|...|.|:| .|:|...::  ..:.|
Zfish   128 TAVTVKCSVKHTC-SSHPPEIIWSVSTVRETISHNPMGGGVWETVSTVNFILTGYEEE--DKIVC 189

Human   267 QVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAG--VVHGAIGGAGVTALLALCL 329
            ..||.|....:..:..|:|..:                |...:|  ::        .::|:.:.:
Zfish   190 NAKFWGGKTQSNSSAPLSVKRI----------------QAVESGPYII--------ASSLVFILI 230

Human   330 CLIFFIVKTHRRKAARTAV 348
            |::..:....||::|..||
Zfish   231 CILAGVFIYRRRQSALIAV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD33XP_011525833.1 Ig 77..193 CDD:299845 32/110 (29%)
IG_like 80..182 CDD:214653 30/99 (30%)
ig 200..281 CDD:278476 23/90 (26%)
LOC108179236XP_021322205.1 Ig 8..99 CDD:325142 31/100 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I12412
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.