DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD33 and si:ch73-380l3.2

DIOPT Version :9

Sequence 1:XP_011525833.1 Gene:CD33 / 945 HGNCID:1659 Length:418 Species:Homo sapiens
Sequence 2:NP_001348166.1 Gene:si:ch73-380l3.2 / 100003913 ZFINID:ZDB-GENE-080303-1 Length:266 Species:Danio rerio


Alignment Length:236 Identity:64/236 - (27%)
Similarity:103/236 - (43%) Gaps:39/236 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    58 LLLLPLLWAGALAMDPNFW-LQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSP---VHGYWFREG 118
            |..|.:|.|..||   :.| :.|:..:......||::||.|.:|:  :.:..|   :.|.|.:  
Zfish     9 LFCLHVLCAVVLA---DVWKVDVEHKMKALVSSCVVLPCNFTYPV--HQQQQPSYRIRGIWHK-- 66

Human   119 AIISRDSPVATNKLDQ--------EVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRME 175
                      .||.|.        .|::..:||.||:|.....||||.|.:.:..|||.|.||:|
Zfish    67 ----------MNKWDDIIFYGDKTLVEDNFKGRTRLIGSLGSFNCSLEIDEVKNTDNGPYCFRVE 121

Human   176 RGST---KYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSW---- 233
            ..:.   |||:....:|:...:...:|.:....::..|......|||...|.. ..|.|||    
Zfish   122 LETAPKDKYSFVDNCVSITTIEEAPKPMLEAETSVLEGEPAIFKCSVRHTCPT-YQPSFSWNRAG 185

Human   234 -LSAAPTSLGPRTTHS-SVLIITPRPQDHGTNLTCQVKFAG 272
             :.::...||.....: |:|..||..:|:.|::.|.||:.|
Zfish   186 KIISSYNDLGHGNWEAESLLTFTPTKEDNYTSIECTVKYHG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD33XP_011525833.1 Ig 77..193 CDD:299845 35/129 (27%)
IG_like 80..182 CDD:214653 31/115 (27%)
ig 200..281 CDD:278476 21/79 (27%)
si:ch73-380l3.2NP_001348166.1 Ig 24..141 CDD:325142 36/130 (28%)
Ig 148..226 CDD:325142 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I12412
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D292012at7742
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.