DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP4K4 and hpo

DIOPT Version :9

Sequence 1:NP_001381931.1 Gene:MAP4K4 / 9448 HGNCID:6866 Length:1384 Species:Homo sapiens
Sequence 2:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster


Alignment Length:594 Identity:176/594 - (29%)
Similarity:282/594 - (47%) Gaps:95/594 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    16 SSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKK----Y 76
            |.|:.|..:|:::..:|.|:||.|||..|.::..:.|||::.|..|..|.|| ||:::::    |
  Fly    33 SLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIK-EISIMQQCDSPY 96

Human    77 SHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGL 141
                 :..|||::.|:    :|  ||:.||:|||||::|:::..| .||.||.||.|..:.|:||
  Fly    97 -----VVRYYGSYFKQ----YD--LWICMEYCGAGSVSDIMRLRK-KTLTEDEIATILSDTLQGL 149

Human   142 AHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENP 206
            .:||:...||||||..|:||......||.||||:.||..|:.:|||.||||:|||||||     .
  Fly   150 VYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI-----E 209

Human   207 DATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKS-KKWSKKFFSFIEGCL 270
            :..||..:|:||.||||:|||||.||..::|||||:|:||:.|||..:. .:||.:|..|:..||
  Fly   210 EIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCL 274

Human   271 VKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSG--------SE 327
            ||....|.:..:||:|.|||:..:    |..||..::.|...| |:......:.|        |.
  Fly   275 VKEPDDRATATELLEHEFIRNAKH----RSILKPMLEETCAIR-EQQRANRSFGGVLAASQAKSL 334

Human   328 EEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQQENKERSEALRRQQ------LLQEQQLREQEE 386
            ..:|...:|....::.:..|| :.:...|...||.:...:..:...:      .|....||...:
  Fly   335 ATQENGMQQHITDNAFMEDPG-TLVPEKFGEYQQSSASDATMIAHAEQGVDEGTLGPGGLRNLSK 398

Human   387 YKRQLLA------------ERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRRREQEEKRRLE 439
            ......|            :....:|.:......:......:....:..: :|:.|.:...:.||
  Fly   399 AAAPAAASSAASPLDMPAVDSGTMVELESNLGTMVINSDSDDSTTAKNND-DQKPRNRYRPQFLE 462

Human   440 ELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLEVLQQQLLQEQAML----------- 493
            ..:|:...:   .|.:|:....    ||.....|::|:..:..|||...||.:.           
  Fly   463 HFDRKNAGD---GRGDEKPIAT----EYSPAAAEQQQQQQQQQQQQQQDEQHLASGANDLNNWEH 520

Human   494 -LECRWREMEEHRQAERLQRQLQQEQAYLLSLQHD-----HRRPH-------PQHSQ-------- 537
             :|.:::::....|....|.|.||:......|.::     :.:|:       |...|        
  Fly   521 NMEMQFQQISAINQYGLQQHQQQQQVLMAYPLMNEQLIALNNQPNLLLSNAAPMGQQGIPAAAPA 585

Human   538 QPPPPQQER 546
            ||||..|.:
  Fly   586 QPPPAYQNQ 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP4K4NP_001381931.1 None
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 120/272 (44%)
S_TKc 42..293 CDD:214567 119/268 (44%)
Mst1_SARAH 608..655 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.