DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstD8

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:88/207 - (42%) Gaps:44/207 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    40 LVLKAKGIRHEVININLK---------NKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDE 95
            :::.||.:.   :::|:|         .||| |.|.||...:|.|.: .|..|:||.....||.|
  Fly    15 VIMTAKALG---VDLNMKLLKVMDGEQLKPE-FVKLNPQHCIPTLVD-DGFSIWESRAILIYLVE 74

Human    96 AY-PGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRS---QNKEDYAGLKEEFRK---EFTKL 153
            .| ....|.|.||.:||....  .|:..:.:|..||:.:   |.:.::....|..:|   .|..|
  Fly    75 KYGADDSLYPSDPQKKAVVNQ--RLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFGHL 137

Human   154 EEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVD----HTPKLKLWMAAMKEDPTVSA 214
            :..|.:::  :..|:.:::.|..:      |.::...|.||    ..|.:..|....||      
  Fly   138 DTFLEDQE--YVAGDCLTIADIAL------LASVSTFEVVDFDIAQYPNVARWYENAKE------ 188

Human   215 LLTS--EKDWQG 224
             :|.  |::|.|
  Fly   189 -VTPGWEENWDG 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 18/62 (29%)