DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO1 and GstD6

DIOPT Version :9

Sequence 1:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:200 Identity:50/200 - (25%)
Similarity:79/200 - (39%) Gaps:26/200 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    26 IYSMRFCPFAERTRLVLKAKGIRHEVININL---KNKPEWFFKKNPFGLVPVLENSQGQLIYESA 87
            :|:|...|......:..||.|:....|.:|.   :....||.|.||...:|.|.::. .:|:|:.
  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNL-FVIWETR 66

Human    88 ITCEYLDEAYPGK--KLLPDDPYEKAC--QKMILE---LFSKVPSLVGSFIRSQNKEDYAGLKEE 145
            ....||.|.| ||  .|.|.||.::|.  |::..:   |:..:.......:|:........| |:
  Fly    67 AIVVYLVEQY-GKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENL-EK 129

Human   146 FRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHT----PKLKLWMA-A 205
            ....|..|...|..:  .:..||.:|:.|.:|      |..:...|.||..    |.:..|.. |
  Fly   130 LNAAFDLLNNFLDGQ--DYVAGNQLSVADIVI------LATVSTTEMVDFDLKKFPNVDRWYKNA 186

Human   206 MKEDP 210
            .|..|
  Fly   187 QKVTP 191

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 18/70 (26%)